SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000047473 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000047473
Domain Number 1 Region: 63-81,168-245,278-378
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000095
Family FAD/NAD-linked reductases, N-terminal and central domains 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000047473   Gene: ENSMUSG00000041153   Transcript: ENSMUST00000037198
Sequence length 550
Comment pep:known chromosome:GRCm38:4:15997121:16013888:-1 gene:ENSMUSG00000041153 transcript:ENSMUST00000037198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVWCCRCSLAGHFRNYSDTETEGEIFNSFVQYFGDNLGPKVKGMPLVEETSLLEDSSVT
LPMVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILHSKLEEARHLSIVDQDLEYLSEG
LEGRSSNPVAVLFDTLLHPDADFGYESPSILHWKLEQHHYIPHLVLGKGPPGGAWHNMEG
SMLTISFGNWMELPGLQFKDWISSKRRNLKGDRVMPEEIARYYKHYVKVMGLQKNFRENT
YITSVSRLYRDQGDNGSQDRDISTKHLQNQKSKFIKRNWEIRGYQRIAGGSHVPFCLFAE
NVALATGTLDSPAHLEVEGEEFPFVFHSMPEFGAAINKGKLCGRVDPVLIVGSGLTAADA
VLCAYNNNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMMCSQSYSADSGPLSDYT
SFPEHRVLSFKADMKCILQSVSGLKKIFKLSAAVILIGSHPNLSFLKEQGCYLGRNSSQP
ITCKGNPVEVDAYTYECVKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKQHLF
VQRGGGDGVA
Download sequence
Identical sequences Q3TEE9
ENSMUSP00000047473 NP_666062.3.92730 10090.ENSMUSP00000047473 ENSMUSP00000047473 ENSMUSP00000047473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]