SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000047991 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000047991
Domain Number 1 Region: 1928-2086
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.17e-25
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0084
Further Details:      
 
Domain Number 2 Region: 2388-2445
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.7e-16
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 3 Region: 3848-3905
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000589
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 4 Region: 3085-3142
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000837
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 5 Region: 2551-2602
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000981
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 6 Region: 2817-2874
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000129
Family TSP-1 type 1 repeat 0.00057
Further Details:      
 
Domain Number 7 Region: 4100-4149
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000157
Family TSP-1 type 1 repeat 0.00092
Further Details:      
 
Domain Number 8 Region: 2662-2718
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000068
Family TSP-1 type 1 repeat 0.0005
Further Details:      
 
Domain Number 9 Region: 3656-3708
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000123
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 10 Region: 3481-3525
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000628
Family TSP-1 type 1 repeat 0.00089
Further Details:      
 
Domain Number 11 Region: 1148-1211
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000327
Family ATI-like 0.033
Further Details:      
 
Domain Number 12 Region: 3791-3848
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000445
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 13 Region: 1289-1330
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 14 Region: 4617-4668
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000314
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 15 Region: 1440-1477
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 16 Region: 2923-2980
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000497
Family ATI-like 0.052
Further Details:      
 
Domain Number 17 Region: 2298-2334
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 18 Region: 3307-3355
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000798
Family TSP-1 type 1 repeat 0.00088
Further Details:      
 
Domain Number 19 Region: 1572-1622
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000837
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 20 Region: 1253-1289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000089
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 21 Region: 3019-3085
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000916
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 22 Region: 2335-2388
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 23 Region: 345-405
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000222
Family BSTI 0.058
Further Details:      
 
Domain Number 24 Region: 2089-2126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 25 Region: 3240-3299
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000288
Family TSP-1 type 1 repeat 0.00088
Further Details:      
 
Domain Number 26 Region: 701-761
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000314
Family ATI-like 0.044
Further Details:      
 
Domain Number 27 Region: 2756-2836
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000387
Family VWC domain 0.055
Further Details:      
 
Domain Number 28 Region: 4462-4515
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000392
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 29 Region: 4669-4727
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000432
Family BSTI 0.05
Further Details:      
 
Domain Number 30 Region: 1627-1666
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000523
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 31 Region: 1688-1747
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000536
Family BSTI 0.053
Further Details:      
 
Domain Number 32 Region: 2238-2277
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000563
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 33 Region: 1329-1365
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000563
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 34 Region: 1369-1407
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000641
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 35 Region: 4776-4837
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000602
Family ATI-like 0.016
Further Details:      
 
Domain Number 36 Region: 4827-4895
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000732
Family VWC domain 0.051
Further Details:      
 
Domain Number 37 Region: 3905-3964
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000154
Family ATI-like 0.05
Further Details:      
 
Domain Number 38 Region: 4004-4058
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000017
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 39 Region: 751-819
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000188
Family Fibronectin type I module 0.025
Further Details:      
 
Domain Number 40 Region: 4272-4328
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000213
Family ATI-like 0.016
Further Details:      
 
Domain Number 41 Region: 1480-1517
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 42 Region: 3728-3775
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000301
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 43 Region: 2610-2658
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000353
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 44 Region: 4528-4578
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000693
Family ATI-like 0.085
Further Details:      
 
Domain Number 45 Region: 2468-2513
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000736
Family ATI-like 0.033
Further Details:      
 
Domain Number 46 Region: 854-895
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000994
Family VWC domain 0.072
Further Details:      
 
Domain Number 47 Region: 4162-4212
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 48 Region: 2879-2918
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000183
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 49 Region: 1768-1826
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000615
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 50 Region: 2718-2783
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000067
Family ATI-like 0.053
Further Details:      
 
Domain Number 51 Region: 3152-3201
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000834
Family BSTI 0.029
Further Details:      
 
Domain Number 52 Region: 3363-3423
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000867
Family ATI-like 0.041
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000047991
Domain Number - Region: 4055-4117
Classification Level Classification E-value
Superfamily FnI-like domain 0.000199
Family Fibronectin type I module 0.084
Further Details:      
 
Domain Number - Region: 1533-1558
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number - Region: 4215-4264
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000288
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number - Region: 3531-3589
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000458
Family BSTI 0.045
Further Details:      
 
Domain Number - Region: 1824-1886
Classification Level Classification E-value
Superfamily FnI-like domain 0.00157
Family Fibronectin type I module 0.077
Further Details:      
 
Domain Number - Region: 404-444
Classification Level Classification E-value
Superfamily FnI-like domain 0.00251
Family VWC domain 0.056
Further Details:      
 
Domain Number - Region: 4902-4992
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.00451
Family Gonadodropin/Follitropin 0.011
Further Details:      
 
Domain Number - Region: 3975-4003
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0424
Family PMP inhibitors 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000047991   Gene: ENSMUSG00000029797   Transcript: ENSMUST00000043676
Sequence length 4998
Comment pep:known chromosome:GRCm38:6:48448229:48501250:1 gene:ENSMUSG00000029797 transcript:ENSMUST00000043676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLALLFGMLWTQANGHWCEQIETVHVEEEVTPRQEDLVPCTSLYHYSRLGWQLDLSWS
GRVGLTRPPALGLCAIYKPPETRPATWNRTVRACCPGWGGAHCTDALAETSPKGHCFVTW
HCQPLAGSANSSAGSLEDPADELGVWPLTLNDPILFPGMSLQWQGDWLVLSGGLGVVVRL
DRSSSISISVDHEFWGRTQGLCGLYNGRPEDDFVEPGGGLATLAATFGNSWKLPGSEPGC
LDAVEVAWGCESLLGGTLTDLEAVKLQAQAQDMCHQLLEGPFWQCHGQVQPDEYHETCLF
AYCVGATAGNGPEGQLEAVCATFANYAQACARQHIYVHWRKPGFCERVCPGGQLYSDCVS
SCPPSCSAVAQGEEGSCGKECVSGCECPTGLFWDGALCVPAAHCPCYHRRQRYAPGDTVK
QQCNPCVCQDGRWHCAQALCPAECAVGGDGHYFTFDGRSFFFRGTPGCHYSLVQDSVKGQ
LLVVLEHGACDTGSCLHALSVFLGNTHIQLRYSGAVLVDGEDVDLPWIGVEGFNISWASS
TFLLLHWPGAWVLWGVAEPAAYITLDPRHAYQVQGLCGTFTWKQQDDFLTPAGDIETSVT
AFASKFQVSGDGRCPLVDKSPLFCSSYSQHLTFTEAACAILHGHAFQECHGLVDREPFRL
RCLEAVCGCAPGRDCLCPVLSAYTRHCAQEGVLLQWRNETLCPVSCPGGQVYQECAPVCG
HHCGEPEDCKELGICVAGCNCPPGLLWDLEGQCVPPSMCHCQFGGHRYTINTTTVRDCSH
CICQERGLWNCTAHHCPRQWALCPRELIYVPGACLLTCDSPRANHSCWAGSTDGCVCPPG
TVLLDKHCVSPDLCPCRHNGQWYPPNATIQEDCNICVCQGQRWHCTGQRCSGWCQASGAP
HYVTFDGLVFTFPGACEYLLVREAGGRFSVSVQNLPCGASGLTCTKALVVRLDSTVVHML
RGQAVTVNGVSIRLPKVYTGPGLSLHHAGLFLLLTTRLGLTLLWDGGTRVLVQLSPHFHG
RVAGLCGNFDSDASNDLRSRQGVLEPTAELTAHSWRLNPLCPEPGDLPHPVNAHRANWAR
ARCEVILQPIFAPCHTEVPPQQYYEWCVYDACGCDTGGDCECLCSAIATYADECARHRHH
VRWRSQELCPLQCEGGQVYEPCGSTCPPTCHDHHSELRWHCQVITCVEGCFCPEGTLLHG
GACMKLAACPCEWQGSFFPPGTVLQKDCGNCTCQGSQWHCDRGGAPCEDMEPGCAEGETL
CRENGHCVPLEWLCDNQDDCGDGSDEEGCATSVCGEGQMSCQSGHCLPLSLICDGQDDCG
DGTDEQGCLCPHGSLACADGRCLPPALLCNGHPDCLDAADEESCLGPVSCISGEVSCVDG
TCVRTIQLCDGVWDCPDGADEGPSHCSLPSLPTPPGGIGQNPSTSSLDTAPSPVGSTSPA
SPCSLLEFQCNSGECTPRGWRCDQEEDCTDGSDELDCGGPCMLYQVPCAHSPHCVSPGQL
CDGVTQCPDGSDEDPDVCEEQSASGGANRTGAPCPEFSCPDGTCIDFLLVCDGNPDCELA
DETEPSLDEQGCGAWGSWGPWAPCSQTCGSGTRSRNRNCSTSSLQVLQNCPGLQHQSQAC
FTEACPVDGEWSSWSPWSPCSEPCGGTTTRHRQCRPPQNGGQDCALLPGSTHSTRQTSPC
PQEGCLNATCFGELVFRTCAPCPLTCDDISGQAACPPDRPCSSPGCWCPDGKVLNTEGQC
VRPRQCPCLVDGAHYWPGQRIKMDCQLCFLDCGWSSWSPWAECLGPCSSQSLQWSFRSPN
NPRLSGHGRQCRGIHRKARRCQTEACEGCEQWGLMYNVGERWRGGPCMVCECLHSSITHC
SPYCPIGSCPQGWVLVEGMGESCCHCALPEKNQTVIHMTTPAPAPASAPSPQIGAHLVTY
VLPPTADACYSPLGLAGLPMWAPSQHWEHITRADPVEAPMAGPGPREGASAEWHTQPLYL
QLDLRRPRNLTGIIVQRAGSSAAYVSTLSLQFSSDNLQWHNYVNSLSSTLSPPKPSPESS
NHMAPEVWTFDQMVQARYIRVWPHSGHLRDNNQHDIFLWVELLGLSPLAPLCPGSRHRCA
SGECAPKGGPCDGAVDCDDGSDEEGCGSLHASTTSRTPALSPTQPGKFPREVSEDLRQGA
EAMTSHSPPSSGETAGLIPASEGTLPVSGQPMQTLSATSTFPPGAKSLHPGMAAVTVHPP
HSVTPGAPVGQTVSPRPFPPMPCGPGQVPCDVLGCVEQEQLCDGREDCLDGSDEQHCASA
EPFTVPTTALPGLPASKALCSPSQLRCGSGECLPFEHRCDLQVNCQDGSDEDNCVDCVLA
PWSGWSDCSRSCGLGLIFQHRELLRLPLPGGSCLLDQFRSQSCFVQACPVAGAWAEWGPW
TACSVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSHEKAPCNLQLCPGDTDCEPGLVHVNA
ELCQKGLVPPCPPSCLDPEANRSCSGHCMEGCRCPPGLLLQDSHCLPLSECPCLVGQKLI
QPRLAFLLDNCSQCICEKGTLLCKPGACSQSCGWSAWSPWTACDRSCGSGVRARFRSPTN
PPVAFGGSPCEGDRQELQACYTDCGTEIPGWTPWTSWSSCSQSCLVPGGDPGWRQRSRLC
PSSRDTFCPGEATQEEPCSPPVCPVPSAWGLWASWSTCSASCNGGIQTRGRSCSGSAPGN
PVCLGPHTQTRDCNMHPCTAQCPGNMVFRSAEQCLEEGGPCPQLCLAQDPGVECTGSCAP
SCNCPPGLFLHNASCLPRSQCPCQLHGQLYAPGAVAHLDCNNCTCISGEMVCTSKRCPVA
CGWSPWTPWSPCSQSCNVGIRRRFRAGTEPPAAFGGAECQGPNLDAEFCSLRPCRGPGAA
WSSWTPCSVPCGGGYRNRTQGSGPHSPIEFSTCSLQPCAGPVPGVCPEDQQWLDCAQGPA
SCAHLSIPGEANQTCHPGCYCLSGMLLLNNVCVPVQDCPCAHRGRLYSPGSAVHLPCENC
SCISGLITNCSSWPCEEGQPAWSSWTPWSVCSASCNPARRHRHRFCARPPHRAPFSLVLL
TTVAAPTTLCPGPEAEEEPCLLPGCNQAGGWSPWSPWSGCSRSCGGGLRSRTRACDQPSP
QGLGDFCEGPQAQGEACQAQPCPVTNCSAMEGAEYSPCGPPCPRSCDDLVHCVWRCQPGC
YCPLGKVLSADGAICVKPSYCSCLDLLTGKRHHAGTQLMRPDGCNHCTCMEGRLNCTDLP
CQVSGDWCPWSKWTACSQPCRGQTRTRSRACVCPAPQHGGSPCPEESGGTGVQHQMEACP
NATACPVDGAWSPWGPWSSCDACLGQSYRSRVCSHPPISDGGKPCLGGYQQSRPCRNSST
LCTDCGGGQDLLPCGQPCPHSCQDLSLGSTCQPGSAGCQSGCGCPPGQLSQDGLCVFPVD
CHCHFQPRAMGIPENRSRSVGSTLSSWESLEPGEVVTGPCDNCTCVAGILQCHEVPSCPG
PGIWSSWGPWEKCSVSCGGGEQLRSRQCARPPCPGLAQQSRICHIHVCRETGCPAGRLYR
ECQPSDGCPFSCAHVTGQVACFSERCKEGCHCPEGTFQHHVACVQECPCVLTVLLLQELG
LASAALGSYPTLLGDEGKPLGPGVELLPGQMLQTDCGNCSCVHGKLSCSMVECSRVHGSF
GPWGMWSLCSRSCGGLGTRTRTRQCVLPTLAPGGLSCRGPLQDLEYCFSPECPGTAGSTV
EPVTGLAGGWGPWSPWSPCSHSCTDPAHPAWRSRTRLCLANCTVGDSSQERPCNLPSCAA
LLPCPGPGCGSGNCFWTSWAPWEPCSRSCGVGQQRRLRAYHPPGPGGHWCPDILTAYQER
RFCNLRACPVPGGWSHWSPWSWCDRSCGGGRSLRSRSCSSPPPKNGGTSCVGERHHVRPC
NPMPCEEGCPAGMEMVSCANHCPYSCSDLQEGGMCQEDQACQLGCRCSEGFLEQDGGCVP
VGHCECTDAQGRSWAPGSQHQDACNNCSCQAGQLSCTAQLCSPPAHCAWSHWSAWSSCSH
SCGPQGQQSRFRSSTSGSWALECQKEQSQSQPCPEVPCPPLCLHEAHLHELGDNWLHGEC
QQCSCTPEGAICKDTDCAVPRGWTLWSSWSYCSVSCGGGSQVRTRSCTVSAPPHGSLSCE
GPDTQTRHCGQQLCLQKLERCSWGPWGPCSRSCGTGLASRSGSCPCLLTKEDSKCNDTFL
GLDTQACYSGPCQDDCTWGDWSSWTRCSCKVLVQQRYRHQVPAPGQAGEGTPCTRLDGHF
RPCTIGNCSEDSCPPPFEFQSCGSPCAGLCATHLNHRLCQDLPPCQPGCYCPKGLLEQAG
SCILPEQCNCWHISGEGARVTLAPGDRLQLGCKECVCRRGELQCSSQGCEGLLPLTGWSE
WSPCGPCLPQSALAPASRTALEGHWPLNTSDLPPPSVTLLASEQYRHRLCLDPETRRPWA
GDPALCTVPLSQQRLCPDPGACNDTCQWGPWGPWSPCQMPCSGGFKLRWRVARDTSAGEC
PGPWAQTESCNMGSCPGESCETRDTVFTLDCANQCPRSCADLWDGVQCLQGPCSPGCRCP
PGQLVQDGHCVPISSCRCGLPSANASWELAPTQVVQLDCHNCTCINGTLMCPHLECPVLG
PWSAWSECSAVCGKGTMVRHRSCEEHPDREPCQALDLQQWQECNLQACPECPPGQVLSTC
ATMCPSLCSHLWPGTICVREPCQLGCGCPGGQLLYNGTCIPPEACPCTQFSLPWGLTLPL
EEQARELPSGTVLTRNCTHCTCQGGAFICSLTDCQECAPGEIWQHGKLGPCEKTCPEMNM
TQAWSNCTEAQAPGCVCQLGYFRSQTGLCVPEDHCECWHHGSPHLPGSEWQEACESCRCL
HGKSVCIRHCPELSCAQGEVIMQEPGSCCPICQQDTLKEEPVSCRYLTELRNLTKGPCHL
DQIEVSYCSGHCRSSTNVMTEEPYLQSQCDCCSYRLDPDSPVRILNLLCPDGHTEPVVLP
VIHSCQCSACQGGDFSKH
Download sequence
Identical sequences Q8CG65
ENSMUSP00000047991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]