SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000048148 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000048148
Domain Number 1 Region: 243-299
Classification Level Classification E-value
Superfamily SH3-domain 7.22e-18
Family SH3-domain 0.00062
Further Details:      
 
Domain Number 2 Region: 81-139
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.42e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.006
Further Details:      
 
Domain Number 3 Region: 305-360
Classification Level Classification E-value
Superfamily SH3-domain 0.0000367
Family SH3-domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000048148   Gene: ENSMUSG00000040287   Transcript: ENSMUST00000035839
Sequence length 360
Comment pep:known chromosome:GRCm38:10:127501717:127508815:1 gene:ENSMUSG00000040287 transcript:ENSMUST00000035839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKEVVESPQPPFPGETPQSGLQRLKQLFKKGSPETAEMEPPPEPQANGEAVGAGGGPI
YYIYEEEEEEEEEEEPPPEPPKLVNDKPHKFKDHFFKKPKFCDVCARMIVLNNKFGLRCK
NCKTNIHEHCQSYVEMQRCFGKIPPGFRRAYSSPLYSDQQYAVSAANRNDPVFETLRVGV
IMANKERKKGQADKKNPLAAMMEEEPESARPEEGKSQDGNNAEKDKKAEKKTPDDKNKQP
GFQQSHYFVALYRFKALEKDDLDFPPGEKITVIDDSNEEWWRGKIGEKVGFFPPNFIIRV
RAGERVHRVTRSFVGNREIGQITLKKDQIVVQKGDEAGGYVKVYTGRKVGLFPTDFLEEI
Download sequence
Identical sequences Q8BZ71
ENSMUSP00000048148 ENSMUSP00000125124 ENSMUSP00000048148 10090.ENSMUSP00000048148 ENSMUSP00000048148 NP_808375.1.92730 XP_006513703.1.92730 XP_006513705.1.92730 XP_021061110.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]