SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000048451 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000048451
Domain Number 1 Region: 14-287
Classification Level Classification E-value
Superfamily Ras GEF 1.83e-68
Family Ras GEF 0.0001
Further Details:      
 
Domain Number 2 Region: 366-489
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-17
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000048451   Gene: ENSMUSG00000038831   Transcript: ENSMUST00000042615
Sequence length 497
Comment pep:known chromosome:GRCm38:2:33133421:33371481:-1 gene:ENSMUSG00000038831 transcript:ENSMUST00000042615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFAELASC
GWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAEILSHFVKIAKKLLELNN
LHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSKEDNYKRTRDYIRSLKMV
PSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLTTLPH
VQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAGPSAGSSSARFRRR
PTCPDTSVAGSLPTPPVPRHRKSHSLGNKGRLYATLGPNWRVPVRNSPRTRSCVYSPTSP
CTCTVGSSATVPTMEGPLRRKTLLKEGRKPALSSWTRYWVVLSGATLLYYGAKSLRGTDR
KHYKSTPGKKVSIVGWMVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRFHAILWHKHLDD
ACKSSRPQVPANLMSFE
Download sequence
Identical sequences ENSMUSP00000048451 NP_001277499.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]