SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000048721 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000048721
Domain Number 1 Region: 22-148
Classification Level Classification E-value
Superfamily Lysozyme-like 2.28e-47
Family C-type lysozyme 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000048721   Gene: ENSMUSG00000037167   Transcript: ENSMUST00000040437
Sequence length 160
Comment pep:putative chromosome:GRCm38:X:21068406:21077963:1 gene:ENSMUSG00000037167 transcript:ENSMUST00000040437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVCSIVVVILAVLLIAKLDAKIYERCELAKKLEEAGLDGFKGYTVGDWLCVAHYESGFD
TSFVDHNPDGSSEYGIFQLNSAWWCNNGITPTQNLCNIDCNDLLNRHILDDIICAKRVAS
SHKSMKAWDSWTQHCAGHDLSEWLKGCSVRLKTDSSYNNW
Download sequence
Identical sequences A0A077S1H9 A2AE20
NP_001078862.1.92730 ENSMUSP00000048721 ENSMUSP00000048721 10090.ENSMUSP00000048721 ENSMUSP00000048721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]