SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000049145 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000049145
Domain Number 1 Region: 402-659
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-48
Family YWTD domain 0.000000091
Further Details:      
 
Domain Number 2 Region: 193-232
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000249
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 3 Region: 31-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000681
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 4 Region: 107-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000367
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 5 Region: 231-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000038
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 6 Region: 70-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.0006
Further Details:      
 
Domain Number 7 Region: 146-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000772
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 8 Region: 355-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000692
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 9 Region: 277-314
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0004
Further Details:      
 
Domain Number 10 Region: 319-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000552
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 11 Region: 663-709
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000969
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000049145   Gene: ENSMUSG00000024924   Transcript: ENSMUST00000047645
Sequence length 804
Comment pep:novel chromosome:GRCm38:19:27217357:27249727:1 gene:ENSMUSG00000024924 transcript:ENSMUST00000047645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSARWALWLLLALCWAPRDSGATASGKKAKCDSSQFQCTNGRCITLLWKCDGDEDCAD
GSDEKNCVKKTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQCRNITCSADEFTC
SSGRCVSRNFVCNGQDDCDDGSDELDCAPPTCGAHEFQCSTSSCIPLSWVCDDDADCSDQ
SDESLEQCGRQPVIHTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPD
QFECEDGSCIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDMSKVCDQE
QDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQ
NPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEY
IQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASIDDKVGRHFKMIDNVYNPAAIAVD
WVYKTIYWTDAASKTISVATLDGAKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEPAKI
EKAGMNGFDRRPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSL
EFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPS
GKNWCEDDMENGGCEYLCLPAPQINDHSPKYTCSCPNGYNLEENGRECQRINVTTAVSEV
SVPPKGTSAAWAILPLLLLVMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKTTEEDLSIDI
GRHSASVGHTYPAISVVSTDDDLA
Download sequence
Identical sequences F8WGI9
XP_017173627.1.92730 ENSMUSP00000049145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]