SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000050424 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000050424
Domain Number 1 Region: 51-190
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.13e-16
Family YhhF-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000050424   Gene: ENSMUSG00000025956   Transcript: ENSMUST00000053469
Sequence length 218
Comment pep:known chromosome:GRCm38:1:64606480:64617168:-1 gene:ENSMUSG00000025956 transcript:ENSMUST00000053469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVPYEESAAIGLQKFHKPLATFSFANHTIQIRQDWRQLGVAAVVWDAAVVLSMYLEMG
AVELRGCSAVELGAGTGLVGIVAALLGAQVTITDRKVALEFLKSNVEANLPPHIQPKAVV
KELTWGQNLESFSPGEFDLILGADVIYLEDTFTDLLQTLGHLCSNNSVILLACRIRYERD
SNFLTMLERQFTVSKVHYDPEKDVHIYKAQKRNQREDL
Download sequence
Identical sequences Q9CQL0
10090.ENSMUSP00000109713 MmR250 NP_080240.1.92730 XP_006496266.1.92730 XP_006496267.1.92730 ENSMUSP00000050424 ENSMUSP00000050424 ENSMUSP00000050424 ENSMUSP00000109713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]