SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000050496 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000050496
Domain Number 1 Region: 542-605,779-898
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.2e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0068
Further Details:      
 
Domain Number 2 Region: 8-96,123-200
Classification Level Classification E-value
Superfamily RUN domain-like 6.41e-34
Family RUN domain 0.0017
Further Details:      
 
Domain Number 3 Region: 876-997
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.15e-25
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000050496   Gene: ENSMUSG00000038351   Transcript: ENSMUST00000057631
Sequence length 1005
Comment pep:known chromosome:GRCm38:11:74849261:74897060:-1 gene:ENSMUSG00000038351 transcript:ENSMUST00000057631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSAEDAVKEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAA
GFLRSDKMAALFTKVGKTCPVAEDICHKVQELQQQAEGRKPSGGSQEALRKQGSTGGKAP
ALSPQALKHIWVRTALMEKVLDRVVQYLAENCSKYYEKEALLADPVFGPILACLLVGPCA
LEYTKLKTADHYWTDPSADELVQRHRIRGPPNRQDSPAKRPALGIRKRHSSGSASEDRLA
ACAREYVESLHQNSRTRLLYGKNNVLVQPKEDMEAVPGYLSLHQSAENLTLKWTPNQLMN
GTLGDSELEKSVYWDYALVVPFSQIVCIHCHQQKSGGTLVLVSQDGIQRPPLHFPQGGHL
LSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPKLRKRSSIRSIDVEELGVGRATDYVFRI
IYPGHRHEHNAGDMIEMQGFGPSLTAWHLEPLCSQGSSCLSCSSSSSPYATPSHCSCIPD
RLPLRLLCESMKRQIVSRAFYGWLAYCRHLSTVRTHLSALVHHNIIPPDRPPGASGGLTK
DVWSKYQKDEKNYKELELLRQVYYGGVEHEIRKDVWPFLLGHYKFGMSKKEMEQVDTAVA
ARYQQVLAEWKACEVVVRQREREAHPATLTKFSSGSSIDSHVQRLVHRDSTISNDVFISV
DDLEPSGPQDLEDSKPKREQEPGAGTPGIAAAEQQSVEFDSPDSGLPSSRNYSVASGIQS
SLDEAQSVGFEDDGAGEDGSEGPATAAHTFPGPHDPGQETLAPASELEAGQELAAVCAAA
YTIELLDTVALNLHRIDKDVQRCDRNYWYFTTSNLERLRDIMCSYVWEHLDMGYVQGMCD
LLAPLLVILDNDQLAYSCFSHLMKRMGQNFPSGGAMDSHFANMRSLIQILDSELFELMHQ
NGDYTHFYFCYRWFLLDFKRELLYEDVFAVWEVIWAARRISSEHFVLFIALALVEAYREI
IRDNNMDFTDIIKFFNERAERHDAQEILRIARDLVHKVQMLIDNK
Download sequence
Identical sequences Q80U12
NP_922934.2.92730 ENSMUSP00000050496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]