SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000050535 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000050535
Domain Number 1 Region: 325-545
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.78e-49
Family Reprolysin-like 0.0031
Further Details:      
 
Domain Number 2 Region: 1090-1146
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000196
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 638-688
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 4 Region: 918-979
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 983-1039
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000183
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 1042-1085
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000811
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000050535   Gene: ENSMUSG00000053441   Transcript: ENSMUST00000052907
Sequence length 1210
Comment pep:known chromosome:GRCm38:18:58836764:59053678:1 gene:ENSMUSG00000053441 transcript:ENSMUST00000052907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPEMRLTRICCCCCLLYQLGFLSHGTTSGLQLTPDLEEWEVVFPALWRRESLNATGLSG
GSSDPGSGRSSGGGGRGQASGSSREVRSVARAPQEEATRGQSEPWFGSPLEPGAEDEEEL
ESQELPRGSSGDTALSSGTPASWQPPLPPQRPSSPPPAQQEEPSAEEVLLRIPALSRDLY
LLLRRDGRFLAQRFAVEQWPKPGPDPTRATADPGSSLLPDASCFYTGTVLRHPGSLASFS
TCGGGLMGFIQLNEDFLFIEPFNDTMAIIGHPHRLYRQKRSTEEKVTENSAVHRHHCGVI
SDKGRPRSKKIADNRREKRYSYKLSQEYNIETVVVADPAMVSYHGADAARRFILTILNMV
FNLFQHKSLGVQVNLRVLKLILLHETPADLYIGHHGEKMLESFCKWQHEEFGRRNDVHLE
MSTSWGEDIAAVDAAILITRKDFCVHKDEPCDTVGIAYLNGMCSEKRKCIIAEDNGLNLA
FTIAHEMGHNMGINHDNDHPSCADGLHIMSGEWIKGQNLGDVSWSRCSKEDLERFLRSKA
SSCLLHTDPQSLSSVLVPSKLPGMAYTADEQCQILFGPLASFCQEMQHVICTGLWCKVEG
EAECRTKLDPPMDGTDCDPGKWCKAGECTRRTPAPEHLAGEWSPWSSCSRSCSSGVSSRE
RKCPGLGSEARDCNGPRKQYRICENPPCPAGLPGFRDWQCQAYSVRTSYPKHALQWQAVF
DEEKPCALFCSPVGKEQPVLLSEKVMDGTSCGYQGLDICANGRCQKAGCDGLLGSLARED
HCGVCNGNGKSCKVIKGDFNHTRGAGYVEVLVIPAGARRIKVVEEKPAHSFLALRDASKQ
SINSDWKIEHSGAFSLAGTTVHYLRRGLWEKISAKGPTTTPLHLLVLLFQDQNYGLHYEY
TVPSDPLPDNQSSKEPGPLFMWTHAGWGDCNATCGGGERKTMVSCTKIMSKNISLVDNKK
CKDLTKPEPQIRKCNEQPCQTRWMMTEWTTCSRTCGKGVQSRQVACTQQLENGTLIRAWE
RDCLGPKPATVQRCEGQDCMTVWEAGVWSECSVKCGKGVRHRTVRCTNPRKKCVLSTRPR
EAEDCEDYSKCYVWRVGDWSKCSITCGKGMQSRVIQCMHKITGRHGNECFSSEKPAAYRP
CHLQPCNEKINVNTITSPRLAALTFKCLGDQWPVYCRVIREKNLCQDMRWYQRCCETCRD
FYAQKLQQKS
Download sequence
Identical sequences P59509
ENSMUSP00000050535 NP_780715.1.92730 ENSMUSP00000050535 10090.ENSMUSP00000050535 ENSMUSP00000050535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]