SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000050586 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000050586
Domain Number 1 Region: 1217-1392,1443-1488,1522-1700
Classification Level Classification E-value
Superfamily Ras GEF 8.24e-58
Family Ras GEF 0.00079
Further Details:      
 
Domain Number 2 Region: 456-594
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000347
Family Protein kinases, catalytic subunit 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000050586
Domain Number - Region: 36-173
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000542
Family Protein kinases, catalytic subunit 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000050586   Gene: ENSMUSG00000066129   Transcript: ENSMUST00000053445
Sequence length 1742
Comment pep:known chromosome:GRCm38:7:139894696:139941537:1 gene:ENSMUSG00000066129 transcript:ENSMUST00000053445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAMDPASRGFYEEDGKDLDFYDFEPLPTLPEDEENVSLADILSLRDRGLSEQEAWAVCL
ECSLSMRSVAHAAIFQTLCITPDTLAFNTSGNVCFMEQLSDDPEGAFVPPEFDLTGNTFE
AHIYSLGATLKAALEYVPEPELEPKLSTDLEGLLSQMQAEDPRERPDLASIIALCEEKMQ
PVSSCRLCRSLSAIGRRVLSIESFGAFQELSENTWRGRPAPRNVGPKKMPGDLSTDPEAL
FPSKGLLQPPASRDAEQEAGQRPRAPSPKPLLSAPVRNGENPGQEGLADLVLDARCPLGE
LDRDNLRRSRLKKAQTFPRLLQESTETSTLCLSLNGSRNQLAISEFFPPDPRKLFLEGKN
GLSGFKTQSKSRLWPEQEPGVQLDKTPGAGRNPHRSPGASGQLEASSPSQGSVEYKPSPS
PVDAGDSDHEGHIPRSEEKIPEESRQPGSTATEQSLSLKDLLSKLGRPFREYELWALCLS
CLSTLQTHKEHPAHLCLDNVLVAEDGTVFFGPPPANGAYNSLFLAPEVSEEKLVTEKASV
YCVAAVLWTAAKFSVPRDHKLALPRRLKTLLLDMARRHASERPSAAEAIKVCSSYLLQRG
MDSSKILAHLRASTCKVHPEEETIGLQNAFSVVELKSTTAPAPESSPGFLQVSNDTKLVA
VPGPVPGLPPCCKEACELPAAFTSEATHFKPIVLAQDASVTRDQLALPSESNEKPKEGSG
HLDREGTRKQAALELVEATDLKMSNQLSPGPELQGATPDPDGDSGSPSSATECSCPHGPA
LVTQQKGTSGTPSSPASSLPPEHRPDGEGPLGTTVLPGPTSASQGSRHPCKPPRGKAAAS
PSSPRGSDGHPEKPRPADRKLCPSSVDTSSPPKMTACPSLQEAMRLIQEEFAFDGYMDNG
LEALIMGEYIYALKDLTFATFCGAISEKFCDLYWDEQLLKNLFKVVNGPASPSESTSEEP
GSQPEHSPSRCSLSSKRPSLHGLGKEKPATTWGSGGPCSPTALSDIDSDTLSQGNFEVGF
RSQKSIKVTREQQPEAEVGGQPGPSQDSTSHASDTVARLARSEDGGPAGSPGASDFQNCS
PGWSSAFYEADCFGADVYNYVKDLERQKTNGHTELEAQSPELEQQLMIEKRNYRKTLKFY
QKLLQKEKRNKGSEVRTMLSKLRGQLDEMKSKVQFLSLVKKYLQVMYAERWGLEPCALPV
IVNIAAAPCDTLDFSPLDESSSLIFYNVNKHPGSGRQKKARILQAGTPLGLMAYLYSSDA
FLEGYVQQFLYTFRYFCTPHDFLHFLLDRISSTLSRAHQDPTSTFTKIYRRSLCVLQAWV
EDCYTVDFIRNAGLLGQLEDFISSKILPLDGTAEHLLALLEVGTERRADSASRGADLEDP
KEAEEDTRPFNALCKRFSEDGITRKSFSWRLPRGNGLVLPHHKERQYTIASALPKPCFFE
DFYGPYAKASEKGPYFLTEYSTNQLFTQLTLLQQELFQKCHPVHFLNSRALGVMDKSAAI
PKASSSESLSAKTCSLFLPNYVQDKYLLQLLRNADDVSTWVAAEIVTSHTSKLQVNLLSK
FLLIAKSCYEQRNFATAMQILGGLEHLAVRQSPAWRILPAKIAEVMEELKAVEVFLKSDS
LCLMEGRRFRAQPTLPSAHLLAMHIQQLETGGFTMTNGAHRWSKLRNIAKVASQVHAFQE
NPYTFSPDPKLQAHLKQRIARFSGADVSILAADNRANFHQIPGEKHSRKIQDKLRRMKAT
FQ
Download sequence
Identical sequences Q0KK55
ENSMUSP00000050586 10090.ENSMUSP00000050586 ENSMUSP00000050586 NP_796235.4.92730 ENSMUSP00000116435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]