SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000050999 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000050999
Domain Number 1 Region: 459-564
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000151
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000050999   Gene: ENSMUSG00000039908   Transcript: ENSMUST00000050880
Sequence length 593
Comment pep:known chromosome:GRCm38:11:119355557:119381079:1 gene:ENSMUSG00000039908 transcript:ENSMUST00000050880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPDTCCCSATALRRRLPVLAWVPDYSLQWLRLDFIAGLSVGLTVIPQALAYAEVAGLPP
QYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTFREPAYAVLLAFLSGCIQLAM
GLLHLGFLLDFISCPVIKGFTSAASITIGFGQIKNLLGLQKIPRQFFLQVYHTFLHIGET
RVGDAVLGLASMLLLLVLKCMREHMPPPHPEMPLAVKFSRGLVWTVTTARNALVVSSAAL
IAYAFEVTGSHPFVLTGKIAEGLPPVRIPPFSVTRDNKTISFSEMVQDMGAGLAVVPLMG
LLESIAVAKSFASQNNYRIDANQELLAIGLTNVLGSLVSSYPVTGSFGRTAVNAQTGVCT
PAGGLVTGALVLLSLNYLTSLFSYIPKSALAAVIITAVTPLFDVKIFRSLWRVQRLDLLP
LCVTFLLSFWEIQYGILAGSLVSLLILLHSVARPKTQVSEGQIFVLQPASGLYFPAIDAL
REAITNRALEASPPRSAVLECTHISSVDYTVIVGLGELLEDFQKKGVALAFVGLQVPVLR
TLLAADLKGFRYFTTLEEAEKFLQQEPGTEPNSIHEDAVPEQRSSLLKSPSGP
Download sequence
Identical sequences Q80ZD3
ENSMUSP00000050999 ENSMUSP00000050999 10090.ENSMUSP00000050999 NP_848858.2.92730 ENSMUSP00000050999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]