SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000051163 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000051163
Domain Number 1 Region: 388-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.04e-35
Family Calponin-homology domain, CH-domain 0.00014
Further Details:      
 
Domain Number 2 Region: 87-241,387-437
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.4e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.073
Further Details:      
 
Domain Number 3 Region: 746-778
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000157
Family LIM domain 0.013
Further Details:      
 
Domain Number 4 Region: 779-808
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000264
Family LIM domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000051163   Gene: ENSMUSG00000038244   Transcript: ENSMUST00000050149
Sequence length 960
Comment pep:known chromosome:GRCm38:7:112225856:112355194:1 gene:ENSMUSG00000038244 transcript:ENSMUST00000050149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENEDEKQAQASQVFENFVQATTCKGTLQAFNILTCLLDLDPLDHRNFYSQLKSKVNTW
KAKALWHKLDKRGSHKEYKRGKACSNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDT
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEVHVN
VEFVRVLEPPEDQENQKVGWRAEFLPADHALSDFEFDVIIGADGHRNTLEGFRRKEFRGK
LAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDSTHYFV
MTAKKQSLLDKGVILNDYIDTEMLLCSENVNQDNLLSYAREAADFATNYQLPSLDFAINH
NGQPDVAMFDFTSMYASENAALMRERQAHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVKSWDQGTPPLEVLAERESLYRLLPQTTPENINKNFEQYTLDPATRYPNLNLHCVR
PHQVKHLYITKEMDRFPLERWGSVRRSVSLSRRESDIRPNKLLTWCQQQTKGYQHVRVTD
LTTSWRSGLALCAIIHSFRPELINFDSLNEDDAVENNQLAFDVAKREFGILPVTTGKEMA
STQEPDKLSMVMYLSKFYELFRGTPLRPMDSWRKNYGENADFGLGKTFIQNNYLNLTLPR
KRTPRVDTQTEENDMNKRRRQGFNHLEELPSFSSRSLGSSQEYAKESGSQNKVKHMANQL
LAKFEENTRNPSVVKQESPRKAFPLSLGGRDTCYFCKKRVYMIERLSAEGHFFHQECFRC
SVCSATLRLAAYAFDCDEGKFYCKPHFVHCKTSSKQRKRRAELNQQREEEGTWQEQEAPR
RDVPTESSCAVAAISTPEGSPPGTSTSFFRKALSWPLRLTRGLLNLPQSLLRWMQGLQEA
AGHHVRDNAHNYCFMFELLSLGLLLLWAFSKVLAAMYRESEESLENIRSWLLRFIPVKLQ
Download sequence
Identical sequences Q8BML1
NP_796256.1.92730 ENSMUSP00000051163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]