SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000052089 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000052089
Domain Number - Region: 416-475
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0017
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000052089   Gene: ENSMUSG00000047014   Transcript: ENSMUST00000055156
Sequence length 1109
Comment pep:known chromosome:GRCm38:12:101404673:101626009:1 gene:ENSMUSG00000047014 transcript:ENSMUST00000055156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPLIYVMLVLLNVFVFSSGVIHNKGKERTYFSCSGEGILTGLHTIKLFLTMDNLKVRC
FFRNENQSPSKEILGLFTSGGLAPNMIITNSTFYGGYYFKLTPFSNRLEWLIDIPRQNIT
VNTDIAAVEQWMIKITMHEGLNIYDTEGTLLDLVREPILQWNLGRVLTEMEVRDLYPEVN
DIKVTKSPCANDVALIGFMMKPSSNGVFIGKTISGFWTYKECIWHDLTEIIYAELKDEHQ
GLTVIDLVLTNHFLVILTSLGLYVSSDLRYPTTSQIKLSRAEFCGFERVDYIRGNLWYNE
KCFANRESFEVDYVTITFNRNRTLSESSSCFFSKEPFLHWLPCVFSTIKNEKSIPRVITF
LIDQETDSGIYLFNVQDTKETYVTVAMLKDGKPSPRPKFPSFHFPSTFTLPLGMIFHPRS
HFLYVYGSQIWVSMDGGNTFEMLCNLFSHHVTKTSNSFYTSDIVFIVEDGRILTTKAGLT
TYSELGILKDAIFTLYYDQLGYIHKLTPENFDAGSKLLGHGNSGSIFGKRPDLGFEAILV
PQYISTNEMYFFAHVPLTMPTNIQWKKRFKTIHLGKTIEFSKTGLANIKNVYMHKTEPVG
FQTSIHTEIIVPFGIENSKDSPCLLSDLEITYSGKLYYTIKLLSKNPLHELKSTDVEKSV
LIPGYSSFLIMNITDKWTASALATMPQAIKSNLKFLTGSWFLYNFGTAGGRKWSISTRQC
NYWIQQDSLDFMSLNLVKYIDVGNTIDFQFKIIPKAMSTFPIPPVSMVVGNPGLVEVKTQ
GVFDLNENYYLDIHVSGRFFQKGSTSIALVLWEGSSKCYAITLLPTIKSSCSYLRTMHHT
PGRHIPPEDWISGVHKDSQGFNMIKTLPINYRPPSHMGISIPLTDNFYHADPSKPIPRNQ
FHKSKETGKYKQCANVTSRAMCNCSEHQKFSHAVAFSDCKEKVHRFKFPVTQYPVVLEIF
NERDKISAEPPYLVTMTEVNMRKNWQLKHNEPENVKKMKHYLEPLLKTPVYNPLGLNLTI
QGSELFHFKVSVVPGVSFCELSEEFQIYVDEVPLPFPGHALIAVATSVVLGVLIFIAFVF
QLRNIHPLKALKKSIRGNPGLTSSTTVSS
Download sequence
Identical sequences A2RTF1
NP_766611.2.92730 10090.ENSMUSP00000052089 ENSMUSP00000052089 ENSMUSP00000052089 ENSMUSP00000052089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]