SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000052136 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000052136
Domain Number 1 Region: 5-262
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.93e-102
Family Carbonic anhydrase 0.0000000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000052136   Gene: ENSMUSG00000031883   Transcript: ENSMUST00000056051
Sequence length 264
Comment pep:known chromosome:GRCm38:8:104540807:104550343:1 gene:ENSMUSG00000031883 transcript:ENSMUST00000056051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGHHCWGYGQDDGPSNWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELFYEACMSLS
ITNNGHSVQVDFNDSDDRTVVSGGPLEGPYRLKQLHFHWGKKRDMGSEHTVDGKSFPSEL
HLVHWNAKKYSTFGEAAAAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKDTKAQFSC
FNPKCLLPTSRHYWTYPGSLTTPPLSESVTWIVLREPIRISERQMEKFRSLLFTSEDDER
IHMVDNFRPPQPLKGRVVKASFQA
Download sequence
Identical sequences Q9ERQ8
ENSMUSP00000052136 ENSMUSP00000125112 NP_444300.1.92730 10090.ENSMUSP00000052136 ENSMUSP00000052136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]