SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000053440 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000053440
Domain Number 1 Region: 63-161
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 2.88e-17
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.003
Further Details:      
 
Domain Number 2 Region: 162-217
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 0.00000000000314
Family Head domain of nucleotide exchange factor GrpE 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000053440   Gene: ENSMUSG00000024580   Transcript: ENSMUST00000062991
Sequence length 224
Comment pep:known chromosome:GRCm38:18:61712440:61726331:-1 gene:ENSMUSG00000024580 transcript:ENSMUST00000062991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARSLWAVQRLQRLLASGAMSESRGWLHPFSTATQRTAGEDCSSEDPPDGLGPSLAEQA
LRLKAVKLEKEVQDLTLRYQRAVADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILE
KTAKCCSEGAEPEDHRRTLEKVFQGLSLLEARLKSVFTKHGLEKMTPIGDKYDPHEHELI
CHMPAGVGVQPGTVALVRQDGYKLHGRTIRLAQVEVAVESQRRL
Download sequence
Identical sequences O88396 Q0VB85
ENSMUSP00000053440 ENSMUSP00000053440 ENSMUSP00000053440 10090.ENSMUSP00000053440 NP_067271.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]