SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000055351 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000055351
Domain Number - Region: 26-97
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0732
Family Transglutaminase, two C-terminal domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000055351   Gene: ENSMUSG00000051729   Transcript: ENSMUST00000060526
Sequence length 139
Comment pep:putative chromosome:GRCm38:14:13157388:13284638:-1 gene:ENSMUSG00000051729 transcript:ENSMUST00000060526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHLSLQCHLQEPRMITSMTVHDRMQLIALLISIILMLHRGCSAEVYWAYVPNPTIIHPV
TWDETVDIPVYVNQTKYLGEYSDGHILQFHAFLNYSGKYEGSLLCFGKNLTENCEQVNIE
DDGTIILMQAYIGPWTFII
Download sequence
Identical sequences Q8C427
ENSMUSP00000055351 ENSMUSP00000055351 ENSMUSP00000055351 ENSMUSP00000124108 10090.ENSMUSP00000055351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]