SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000056500 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000056500
Domain Number 1 Region: 119-240
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-33
Family cAMP-binding domain 0.00000043
Further Details:      
 
Domain Number 2 Region: 248-372
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.2e-32
Family cAMP-binding domain 0.000000522
Further Details:      
 
Domain Number 3 Region: 14-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 6.93e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000056500   Gene: ENSMUSG00000020612   Transcript: ENSMUST00000049527
Sequence length 381
Comment pep:known chromosome:GRCm38:11:109650921:109669656:1 gene:ENSMUSG00000020612 transcript:ENSMUST00000049527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSMATSEEERSLRECELYVQKHNIQALLKDSIVQLCTTRPERPMAFLREYFERLEKE
EARQIQCLQKTGIRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPK
DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQG
EMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGTA
AVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSDILKRNIQQYNSFVSLSV
Download sequence
Identical sequences Q9DBC7
NP_001300902.1.92730 NP_001300903.1.92730 NP_001300904.1.92730 NP_001300905.1.92730 NP_068680.1.92730 XP_017169829.1.92730 ENSMUSP00000056500 ENSMUSP00000056500 ENSMUSP00000102288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]