SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000056640 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000056640
Domain Number 1 Region: 837-890
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000223
Family SH3-domain 0.0022
Further Details:      
 
Domain Number 2 Region: 479-656
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000575
Family RUN domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000056640   Gene: ENSMUSG00000041263   Transcript: ENSMUST00000052539
Sequence length 893
Comment pep:known chromosome:GRCm38:3:89083981:89093363:-1 gene:ENSMUSG00000041263 transcript:ENSMUST00000052539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPQRALLCNLNHIHLQHVSLGLHLSRRPELREGPLSTPPPPGDTGGKESRGPCSGTLV
DANSNSPAVPCRCCQEHGSSIENQQDPSQEEEAVSPSDPGCSSSLSSCSDLSPDESPVSV
YSRDLPGNEDANPQPSTLELGSPLAPAGPSTCSPDSFCCSPDSCSGISSPPGPDLDSNCN
ALTTCQDLPSPGLEEEEDSGEQDLATSELSETEDGRIDAGKAEPSWKINPIWKIDTEKTE
AGWKTIEDSDSGRKTDENTNSSLKTESGKLASCLNTNSGSKIDAGKTDGGWRGDVSQEPV
PHRTITSFHELAQKRKRGPGLPLVPQAKKDRSDWLIVFSPDTELPPTGSLGGSLAPPREV
TTFKELRSRSRAQPPPVPPRDPPAGWALVPPRPPPPPVPPRRKKNRLGLQPIAEGLSEEG
RAASPRAGEEASASQEPEEPRAHAVVRSSWSFAGVPGAQRLWMAEAQSGTGQLQEQKKGL
LIAVSASVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLTTLCPALHALVADGLKPFR
KDLITGQRRSSPWSVVEASVKPGSCTHSMGSLYSQVSRLAPLSSSRSRFHAFILGLLNTK
QLELWFSSLQEDAGLLSLLYLPTGFFSLARGSCPSLATELLLLLQPLSVLTFHLDLLFEH
HHHLPVGLQQAPAPSCPPPALQQTMQAVLHWGERLAQSLRGTSGESTTDSSTPSARPPAG
SWWDQLTQASRVYASGGTEGFPLLRWGPRRHGTTAEAAQEAPPPTEQTTPGRSVWLGRLF
GVPGCPSETESGAFKSRRPSSWLPPTVSVLALVKRGTPPETPPEALVSSPGSVVQADRAV
RALCDHTAAGPDQLSFQRGELLRVIATVDEDWLRCGRDGVEGLVPVGYTSLVL
Download sequence
Identical sequences Q8BG26
ENSMUSP00000056640 NP_001077276.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]