SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000057794 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000057794
Domain Number 1 Region: 217-409
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.01e-53
Family Reprolysin-like 0.00016
Further Details:      
 
Domain Number 2 Region: 429-504
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.41e-19
Family Blood coagulation inhibitor (disintegrin) 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000057794   Gene: ENSMUSG00000046282   Transcript: ENSMUST00000056331
Sequence length 760
Comment pep:known chromosome:GRCm38:8:40793273:40797303:1 gene:ENSMUSG00000046282 transcript:ENSMUST00000056331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTTQRASSFAAAEDNIAMDKAVVYTRIPHLYVWLEILNILSSRPLTGYAQHTSLPEVVI
PLRVTGNRPMWAMGWLTYSLHFGGQKHFIHIKAKKFLVSRLFSVFTYTKQGALHKDQPYV
QNDCYYHGHMDGDPESMVAITTCYGGFQGILQINGTVYEIKPKNLSSTFEHLVHKMDSEE
TELLPMRCALTEEIAKQMKRQQNENPTLMQNHYEEWWTHRSFLDLALVVDCERIRYHNNN
KSHVLVEVFLIISLINKIYFALDIEVVLIGLELWNEGNLVPVDRMQILLEEFCVWKTLSL
NIRIPNDIAHLFVNHSFGKFLGLAYVGTVCLPSHNCGVDRLLGPNLFQFAHIIAHEIGHN
LGMEHDSSSCTCGGINYCLMSSTYSFNPEFSNCSYSNFWTTYATTNCLRKEKMSIGNLQI
QFCGNGVVDDGEQCDCGDRHMCERDQCCNSRCALNDGAACAFGLCCLYCQIMPAGTVCRE
EVNECDLPEWCNGHSHKCPNDVYLLDGSPCRDGGYCYEKRCNNRDEQCKQIFGKEARSAD
HSCYRELNTQGDRFGNCGMIRDAYLRCHDSDILCGRVQCENVTRIPFLRDHSTVHWTHLN
GVTCWGTDYHFGMTIPDIGIVKDGTDCGPEHVCINKKCVSKPIWLEQCSSKTCTMKGVCN
NLHHCHCNRGWDPPHCLESGFGGSVDSGPPPGEEESQQHMDLVLITPILSIVSLVFLLPW
LLNRYIRTSSKFEEPTVSTSKEEEESHVASNESEAQQVET
Download sequence
Identical sequences Q7M763
ENSMUSP00000057794 10090.ENSMUSP00000057794 NP_001009548.1.92730 XP_006509516.1.92730 ENSMUSP00000057794 ENSMUSP00000057794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]