SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000060457 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000060457
Domain Number 1 Region: 39-290
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.23e-91
Family Carbonic anhydrase 0.000000000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000060457   Gene: ENSMUSG00000025317   Transcript: ENSMUST00000057653
Sequence length 299
Comment pep:known chromosome:GRCm38:8:121916126:121944904:-1 gene:ENSMUSG00000025317 transcript:ENSMUST00000057653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRDPRKPLAILRHVGLLCATGPQRWRFQHSCAEEHSNCARHPLWTGPVSSAEGTRQSP
INIQWKDSVYDPQLAPLRVSYDAASCRYLWNTGYFFQVEFDDSCEDSGISGGPLGNHYRL
KQFHFHWGATDEWGSEHAVDGHTYPAELHLVHWNSTKYENYKKASVGENGLAVIGVFLKL
GAHHQALQKLVDVLPEVRHKDTQVAMGPFDPSCLLPACRDYWTYPGSLTTPPLAESVTWI
VQKTPVEVSPSQLSTFRTLLFSGRGEEEDVMVNNYRPLQPLRDRKLRSSFRLDRTKMRS
Download sequence
Identical sequences P23589
ENSMUSP00000060457 10090.ENSMUSP00000060457 ENSMUSP00000060457 NP_031634.2.92730 ENSMUSP00000060457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]