SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000061470 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000061470
Domain Number 1 Region: 527-651,683-753
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 1.78e-33
Family Protein prenylyltransferase 0.016
Further Details:      
 
Domain Number 2 Region: 432-519
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000152
Family Tetratricopeptide repeat (TPR) 0.0047
Further Details:      
 
Domain Number 3 Region: 725-817
Classification Level Classification E-value
Superfamily TPR-like 0.000000000582
Family Tetratricopeptide repeat (TPR) 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000061470
Domain Number - Region: 184-255
Classification Level Classification E-value
Superfamily SIS domain 0.0834
Family mono-SIS domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000061470   Gene: ENSMUSG00000036676   Transcript: ENSMUST00000058154
Sequence length 920
Comment pep:known chromosome:GRCm38:10:100443902:100487350:-1 gene:ENSMUSG00000036676 transcript:ENSMUST00000058154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEGKMADINFKEVTLIVSVVAACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQND
FWGTPMSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNTVFHAVVSVIFLKVCRLFL
DKRSSMIAALLFAVHPIHTEAVTGVVGRAELLSSVFFLAAFLSYTKSKGPDNSIVWTPIV
LTVFLVAVATLCKEQGITVVGICCVYEVFVAQGYTLPMLCTVAGQFLRGKGSIPLSMLQT
LVKLIVLMLSTLLLVVVRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLL
NPSELCCDWTMGTIPLIESFLDVRNLATFAFFCFLGALGIFSLRYPGDSSKTVLMALCLM
ALPFIPASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISNKSVLKKLSWVCLSMVIL
THALKTLHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFEKALKYFLQATHV
QPDDIGAHMNVGRTYKNLNRTREAEASYMLAKSLMPQIIPGKKYAARIAPNHLNVYINLA
NLIRANESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRN
NADLWYNLAIVYIELKEPNEALKNFNRALELNPKHKLALFNSAILMQESGEVKLRPEARK
RLLNYVNEEPQDANGYFNLGMLAMDDKKDSEAESWMKKAIKLQPDFRSALFNLALLYSQT
AKELKALPILEELLKYYPDHTKGLILKGDILMNQKKDIPGAKKCFEKILEMDPSNVQGKH
NLCVVYFEEKELLKAERCLVETLALAPHEEYIQRHLSIVRDRISSSGIVEQPLAPADKTP
GTEEREEIPSEDVKEISSESRPPQILKTNNNRNSKSNKQSTENADQDAPHKTTKDIKEIE
KKRVAALKRLEEIERILNGE
Download sequence
Identical sequences G5E8C4
NP_001103483.1.92730 XP_006513693.1.92730 XP_011241751.1.92730 XP_011241752.1.92730 ENSMUSP00000061470 ENSMUSP00000061470 10090.ENSMUSP00000061470 ENSMUSP00000061470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]