SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000063872 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000063872
Domain Number 1 Region: 15-290
Classification Level Classification E-value
Superfamily Ras GEF 5.1e-81
Family Ras GEF 0.0000406
Further Details:      
 
Domain Number 2 Region: 465-583
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000238
Family Pleckstrin-homology domain (PH domain) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000063872   Gene: ENSMUSG00000026594   Transcript: ENSMUST00000063199
Sequence length 590
Comment pep:known chromosome:GRCm38:1:156808116:156939531:-1 gene:ENSMUSG00000026594 transcript:ENSMUST00000063199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLMNGQASSVTIAATVSEKSSSSESLSEKGSELKKSFDAVVFDVLKVTPEEYAGQITLM
DVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEV
LSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKE
DNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIIS
DLQQSCEYDIPILPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGASTPRSAASREDL
AGPDIGASPQGGRKSSAAAAAAAAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMN
TAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWPA
FERNRLYHSLGPVTRVPRNGYRSHTKASSSAESEDLAVHLYPGAVTIQGVLRRKTLLKEG
KKPTVASWTKYWAALCGTQLFYYAAKSLKATERKHFKSTSNKNVSVVGWMVMMADDPEHP
DLFLLTDSEKGNSYKFQAGSRMNAMLWFKHLSAACQSNKQQVPTNLMTFE
Download sequence
Identical sequences Q9ERD6
ENSMUSP00000063872 ENSMUSP00000130581 ENSMUSP00000139645 10090.ENSMUSP00000063872 ENSMUSP00000027886 ENSMUSP00000063872 NP_001153437.1.92730 NP_001153438.1.92730 NP_076373.3.92730 XP_006497091.1.92730 XP_006497092.1.92730 XP_006497093.1.92730 XP_006497094.1.92730 XP_006497095.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]