SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000064719 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000064719
Domain Number 1 Region: 157-270
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000118
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 262-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000152
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 3 Region: 55-181
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000124
Family Growth factor receptor domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000064719
Domain Number - Region: 300-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000573
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000064719   Gene: ENSMUSG00000024909   Transcript: ENSMUST00000070118
Sequence length 462
Comment pep:known chromosome:GRCm38:19:5474750:5481853:1 gene:ENSMUSG00000024909 transcript:ENSMUST00000070118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGAVAETPDFCPPPPSLRMLPFASCLPGSLLLWAFLLLLLGAASPQDPEEPDSYTECTD
GYEWDADSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVISDLHGEGPPPPAA
HAQQPNPCPQGYEPDEQESCVDVDECTQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPE
CVDIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSY
GTFLCRCNQGYELHRDGFSCSDIDECGYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLC
QDIDECETGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYVQVSDNRCLCPASNPLCREQPS
SIVHRYMSITSERSVPADVFQIQATSVYPGAYNAFQIRSGNTQGDFYIRQINNVSAMLVL
ARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF
Download sequence
Identical sequences G5E8D6
ENSMUSP00000133016 ENSMUSP00000064719 ENSMUSP00000064719 NP_001157824.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]