SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000065213 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000065213
Domain Number 1 Region: 210-412
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.36e-66
Family Reprolysin-like 0.00000375
Further Details:      
 
Domain Number 2 Region: 431-506
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 9.94e-21
Family Blood coagulation inhibitor (disintegrin) 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000065213   Gene: ENSMUSG00000054555   Transcript: ENSMUST00000067680
Sequence length 903
Comment pep:known chromosome:GRCm38:7:133883199:134225097:-1 gene:ENSMUSG00000054555 transcript:ENSMUST00000067680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERPARRAPPARALLLALAGALLAPRAARGMSLWDQRGTYEVARASLLSKDPGIPGQSI
PAKDHPDVLTVQLQLESRDLILSLERNEGLIANGFTETHYLQDGTDVSLTRNHTDHCYYH
GHVQGDAASVVSLSTCSGLRGLIMFENKTYSLEPMKNTTDSYKLVPAESMTNIQGLCGSQ
HNKSNLTMEDVSPGTSQMRARRHKRETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLI
EIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDN
AQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDT
LERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAF
GGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDAVCAHGQCCEDCQLKPPGTAC
RGSSNSCDLPEFCTGTAPHCPANVYLHDGHPCQGVDGYCYNGICQTHEQQCVTLWGPGAK
PAPGICFERVNSAGDPYGNCGKDSKSAFAKCELRDAKCGKIQCQGGASRPVIGTNAVSIE
TNIPQQEGGRILCRGTHVYLGDDMPDPGLVLAGTKCAEGKICLNRRCQNISVFGVHKCAM
QCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQGLTVGILVSILCLLA
AGFVVYLKRKTLMRLLFTHKKTTMEKLRCVHPSRTPSGPHLGQAHHTPGKGLLMNRAPHF
NTPKDRHSLKCQNMDISRPLDARAVPQLQSPQRVLLPLHQTPRAPSGPARPLPASPAVRQ
AQGIRKPSPPQKPLPADPLSRTSRLTSALVRTPGQQEPGHRPAPIRPAPKHQVPRPSHNA
YIK
Download sequence
Identical sequences Q61824
ENSMUSP00000065213 10090.ENSMUSP00000065213 NP_031426.2.92730 ENSMUSP00000065213 ENSMUSP00000065213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]