SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000065292 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000065292
Domain Number - Region: 137-217
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00201
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000065292   Gene: ENSMUSG00000029093   Transcript: ENSMUST00000070720
Sequence length 232
Comment pep:putative chromosome:GRCm38:5:36150202:36398139:-1 gene:ENSMUSG00000029093 transcript:ENSMUST00000070720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHRGPPSAPKRPGPTAPDRSFQALLPPCWPRSWPLLLLLLVLVAACGAMGRSPQPGRQG
PGVQITRLLPAGRTESGDRKDPQARESEPSVPGLGPGSASGPSTDGAPAPGKGRRARAVP
VAGAASASRAQVSLISTSFVLKGDATHNQAMVHWTGENSSVILILTKYYHADMGKVLESS
LWRSSDFGTTYTKLTLQPGVTTVIDNFYICPANKRKGRKLKGKVRVVPSHTS
Download sequence
Identical sequences Q8BI74
ENSMUSP00000065292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]