SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000065542 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000065542
Domain Number 1 Region: 40-333,516-577
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.78e-88
Family FAD-linked reductases, N-terminal domain 0.00015
Further Details:      
 
Domain Number 2 Region: 335-517
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.47e-58
Family GMC oxidoreductases 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000065542   Gene: ENSMUSG00000015970   Transcript: ENSMUST00000067620
Sequence length 596
Comment pep:known chromosome:GRCm38:14:30009023:30040466:1 gene:ENSMUSG00000015970 transcript:ENSMUST00000067620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQVLRGWRKGWQSPRGALAWAVQGQPCPPCSRAVASVGKDEYTFVVVGAGSAGCVLASR
LTEDPNHRVLLLEAGPKDLLMGSKRLQWKIHMPAALVSNLCDDKYNWYYHTEPQPGMDSR
VLYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHREGAEGWDYAHCLPYFRKAQRHELGAN
MYRGGDGPLHVSRGKTNHPLHQAFLQAARQAGYPFTEDMNGFQQEGFGWMDMTVHQGKRW
STACAYLHPVLSRPNLRAEVQTLVSRVLFEGTRAVGVEYIKDGQRHKAYVSREVILSGGA
INSPQLLMLSGVGNADDLRKLDIPVVCHLPGVGQNLQDHLEVYVQQACTQPITLHSAQKP
LRKVCIGLEWLWSYTGDGATAHLETGGFIRSRPGVPHPDIQFHFLPSQVIDHGRKPTQQE
AYQVHVGTMRATSVGWLKLRSANPRDHPVIHPNYLSTETDVEDFRQCVRLSREIFAQEAL
APFRGKELQPGSHVQSDKEIDAFVRAKADSAYHPSCTCKMGRSSDPTAVVDAQTKVIGVE
NLRVVDASIMPSVVSGNLNAPTVMIAEKAADIIKGHPALEDKNVPVYKPQTLDTQR
Download sequence
Identical sequences Q8BJ64
ENSMUSP00000065542 ENSMUSP00000065542 ENSMUSP00000112916 ENSMUSP00000065542 NP_001129712.1.92730 NP_758468.2.92730 NP_780552.1.92730 10090.ENSMUSP00000065542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]