SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000066940 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000066940
Domain Number 1 Region: 477-523
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000327
Family TSP-1 type 1 repeat 0.00063
Further Details:      
 
Domain Number 2 Region: 122-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000117
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 62-111
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000288
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000066940
Domain Number - Region: 432-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000914
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 283-372
Classification Level Classification E-value
Superfamily DAK1/DegV-like 0.068
Family DegV-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000066940   Gene: ENSMUSG00000029656   Transcript: ENSMUST00000065072
Sequence length 523
Comment pep:known chromosome:GRCm38:4:104766395:104804171:1 gene:ENSMUSG00000029656 transcript:ENSMUST00000065072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIGAQVWRALAKSCLLCATLGCLHFPGSRGGKPDFFETKAVNGSLVKSRPVRSVAEAPA
PIDCELSTWSSWTACDPCQKKRYRHTYLLRPSQFYGELCDLSDKEVEDCVTNQPCRSQVR
CEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKNCQREMEQYWAIDRLASGINL
FTNTFEGPVLDHRYYAGGCSPHYILDTNFRKPYNVESYTPQQSKFLHARSVLEVAHYKLK
SRSLMLHYEFLQRVKSLPLEYSYGEYRDLLRDFGTHFITEAVLGGIYEYTLIMNKDAMEQ
GDYTLSHVTACAGGSFGIGGMVYKVYVKVGVSAKKCSDIMKEINERNKRSTMVEDLVVLV
RGGTSEDITALAYKELPTPELMEAWGDAVKYNPAIIKIKAEPLYELVTATDFAYSSTVKQ
NLKKALEEFQSEVSSCRCAPCRGNGVPVLKGSRCECICPGGFQGTACEVTYRKDIPIDGK
WSCWSDWSACSGGHKTRHRQCNNPAPHKGGSPCSGPASETLNC
Download sequence
Identical sequences NP_001303600.1.92730 ENSMUSP00000066940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]