SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000067445 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000067445
Domain Number 1 Region: 9-101
Classification Level Classification E-value
Superfamily Cystatin/monellin 7.09e-25
Family Cystatins 0.000053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000067445   Gene: ENSMUSG00000054905   Transcript: ENSMUST00000068182
Sequence length 103
Comment pep:known chromosome:GRCm38:16:36450537:36455392:-1 gene:ENSMUSG00000054905 transcript:ENSMUST00000068182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQENLKIKGGLSEARPATPEIQMIADKVRPLLEEQTNEKYEKFEAVEYKSQVVAGQNLF
IKIDVGNGCFLHMKVFRGLSGEDDLKLKGYQTNKTKTDELTSM
Download sequence
Identical sequences P35173
10090.ENSMUSP00000067445 NP_079564.1.92730 ENSMUSP00000067445 ENSMUSP00000067445 ENSMUSP00000067445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]