SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000067912 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000067912
Domain Number 1 Region: 97-252
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.35e-31
Family AlaX-like 0.025
Further Details:      
 
Domain Number 2 Region: 2-97
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000353
Family AlaX-M N-terminal domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000067912   Gene: ENSMUSG00000075528   Transcript: ENSMUST00000070395
Sequence length 412
Comment pep:known chromosome:GRCm38:11:101406839:101417615:-1 gene:ENSMUSG00000075528 transcript:ENSMUST00000070395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFLCQRDSYAREFTTTVVSCSPAELQTDASGGKKEVLSGFHVVLEDTLLFPEGGGQPDD
RGTINDISVLRVTRRGAQADHFTESPLSPGSQVQVRVDWERRFDHMQQHSGQHLITAVAD
LLFGLKTTSWELGRLRSVIELDSPSVTAEQVAAIEQSVNQKIRDRLPVSVRELSLDDPEV
EQVRGRGLPDDHAGPIRVVTIEGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNKSNLIF
LAGNRVLKWMERSHGSEKALTSLLKCGVEDHVEAVKKLQNATKLLQKNNLNLLRDLAVHT
AHSLRSSPAWGGVVTLHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGAGLFLLAGPAE
AVETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRAEAQALLQDYVSTQSAEE
Download sequence
Identical sequences Q3THG9
GO.34577 NP_659078.1.92730 ENSMUSP00000067912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]