SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000069011 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000069011
Domain Number 1 Region: 526-847
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.95e-108
Family PDEase 0.0000000000187
Further Details:      
 
Domain Number 2 Region: 137-332
Classification Level Classification E-value
Superfamily GAF domain-like 1.53e-44
Family GAF domain 0.00008
Further Details:      
 
Domain Number 3 Region: 317-521
Classification Level Classification E-value
Superfamily GAF domain-like 9.6e-37
Family GAF domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000069011   Gene: ENSMUSG00000053965   Transcript: ENSMUST00000066728
Sequence length 865
Comment pep:known chromosome:GRCm38:3:122729158:122859374:1 gene:ENSMUSG00000053965 transcript:ENSMUST00000066728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAGPNSVRSQQQRDPDWVEAWLDDHRDFTFSYFIRKATRDMVNAWFSERVHNIPVCKE
GIRAHTESCSCSLQQSPHADNTTPGAPARKISASEFDRPLRPIVVKDSEGTVSFLSDSGK
KEQMPLTPPRFDSDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISADRYSLFLV
CEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPR
FNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFC
GIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIF
IVDEDCPDSFSRVFHMECEEVGKPSDPLTREQDANKINYMYAQYVKNTMEPLNIPDVTKD
KRFPWTNENMGHVNTPCIGSLLCTPIKNGKKNKVIGVCQLVNKMEENTGKIKAFNQNDEQ
FLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRELQALSAAVVPS
AQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWILSVKKNYRKNV
AYHNWRHAFNTAQCMFAALKAGKIQNKLTDLETLALLIAALSHDLDHRGVNNSYIQRSEH
PLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIDEYKTTLKIIKQAILATDLALYIK
RRGEFFELIRKNQFSFEDPLQKELFLAMLMTACDLSAITKPWPIQQRIAELVAAEFFDQG
DRERKELNMEPADLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCLPLLDGCRKNR
QKWQALAEQQEKMLLNGESSQGKRD
Download sequence
Identical sequences Q8CG03
NP_700471.2.92730 10090.ENSMUSP00000069011 ENSMUSP00000069011 ENSMUSP00000069011 ENSMUSP00000069011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]