SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000070560 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000070560
Domain Number 1 Region: 151-346
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.16e-60
Family Astacin 0.0000713
Further Details:      
 
Domain Number 2 Region: 773-885
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-37
Family Spermadhesin, CUB domain 0.00017
Further Details:      
 
Domain Number 3 Region: 467-571
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-36
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 4 Region: 618-728
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-35
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 5 Region: 349-460
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-35
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 6 Region: 909-1002
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-27
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 7 Region: 729-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000519
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 8 Region: 574-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000965
Family EGF-type module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000070560   Gene: ENSMUSG00000053626   Transcript: ENSMUST00000066166
Sequence length 1013
Comment pep:known chromosome:GRCm38:8:64014770:64205993:-1 gene:ENSMUSG00000053626 transcript:ENSMUST00000066166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQALSPRMLLWLVVSGIVFSRVLWVCAGLDYDYTFDGNEEDKTEPIDYKDPCKAAVFW
GDIALDDEDLNIFQIDRTIDLTQSPFGKLGHITGGFGDHGMPKKRGALYQLIERIRRIGS
GLEQNNTMKGKAPPKLSEQSEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQ
AMRHWEKHTCVTFTERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVH
ELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYA
RNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESSGNL
SSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLL
GRFCGDKVAGVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPD
DYRPMKECVWKIMVSEGYHVGLTFQAFEIERHDSCAYDHLEVRDGASENSPLIGRFCGYD
KPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCA
CEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVIAPSQYRISVKF
EFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGADIPEVMTSHFNNMRIEFKSDNTVSK
KGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDCKEAECEQKIHS
PSGLITSPNWPDKYPSRKECTWVISAIPGHRITLAFNEFEVEQHQECAYDHLEIFDGETE
KSPILGRLCGSKIPDPLMATGNEMFIRFISDASVQRKGFQATHSTECGGRLKAESKPRDL
YSHAQFGDNNYPGQLDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVEVFDGLSSKAV
GLGRFCGSGPPEEIYSIGDVALIHFHTDDTINKKGFYIRYKSIRYPETMHAKN
Download sequence
Identical sequences G3X9F5
ENSMUSP00000070560 10090.ENSMUSP00000070560 ENSMUSP00000070560 ENSMUSP00000070560 NP_033416.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]