SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000071368 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000071368
Domain Number 1 Region: 34-198
Classification Level Classification E-value
Superfamily Ras GEF 2.09e-22
Family Ras GEF 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000071368   Gene: ENSMUSG00000061707   Transcript: ENSMUST00000071421
Sequence length 314
Comment pep:known chromosome:GRCm38:5:145029600:145032764:-1 gene:ENSMUSG00000061707 transcript:ENSMUST00000071421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSCFQISRGLGQKKPKRGDLGHFWRRLIRPLTHFWHASHRNPKEPDFPYNLPKFTYNSF
EFVEQMIAYIPAAVHYHDQLSISLFLAVYHRYCSTWEVLDLLMKTYPSFQPDCEQDQLTK
SAIFNFLAHWLDTFPEHFFDSPNLAVMRQLMDYAGRHMPSAEFDKESRELLSRLEEQEAK
KLKLEKDCAATAEQDASRMQENLALRLASVAEPQGDLQPQVDTELLEQSVVEPFVPEPGP
VQLPTFDQALPTSTYTQSPEDVAVDEAADMVADETADEATHEAVDVSPAKQLFLSYTVQL
GTPDFIFSLPKVDI
Download sequence
Identical sequences D3Z0W7
NP_001094933.1.92730 10090.ENSMUSP00000071368 ENSMUSP00000071368 ENSMUSP00000071368 ENSMUSP00000071368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]