SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000073268 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000073268
Domain Number 1 Region: 369-675
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.75e-89
Family Protein kinases, catalytic subunit 0.000000188
Further Details:      
 
Domain Number 2 Region: 226-343
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.2e-33
Family cAMP-binding domain 0.00064
Further Details:      
 
Domain Number 3 Region: 95-218
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.01e-30
Family cAMP-binding domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000073268   Gene: ENSMUSG00000052920   Transcript: ENSMUST00000073581
Sequence length 686
Comment pep:known chromosome:GRCm38:19:30568547:31664370:-1 gene:ENSMUSG00000052920 transcript:ENSMUST00000073581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQA
QKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMK
NLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKV
FGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSL
PDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTREDSPSEDPVFLRTLG
KGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKY
EAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEH
IRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYT
ACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYV
APEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAK
NAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTD
TSNFDSFPEDSDEPPPDDNSGWDIDF
Download sequence
Identical sequences ENSMUSP00000073268 ENSMUSP00000073268 ENSMUSP00000073268 10090.ENSMUSP00000073268 NP_035290.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]