SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000073399 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000073399
Domain Number 1 Region: 70-198
Classification Level Classification E-value
Superfamily Ras GEF 7.45e-19
Family Ras GEF 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000073399   Gene: ENSMUSG00000095040   Transcript: ENSMUST00000073721
Sequence length 219
Comment pep:known chromosome:GRCm38:5:146182441:146185304:-1 gene:ENSMUSG00000095040 transcript:ENSMUST00000073721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSCFQGSRGSSHKKAKSGFLVRFWRRLIRPLSHFRHASHSEPKVCSQNEQEPDCMPRRP
RFNYNSPEYVVQMIHYIPAAVQHNDHVCIRIFLAMYPSYASTWKVLDLLMTTYASFRPDC
VEDQQTKSDVFSFLFHWFKKFPKDFCESPDLDVVRQFIDYVRRNVPSADEDTQARELLSV
LEEQEAIALNTEEVVQSTYVLPMDCIFETNRLISEMGPS
Download sequence
Identical sequences Q80ZR8
ENSMUSP00000073399 10090.ENSMUSP00000073399 NP_001008547.1.92730 ENSMUSP00000073399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]