SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000073598 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000073598
Domain Number 1 Region: 65-192
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-23
Family cAMP-binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 201-265
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000932
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000073598   Gene: ENSMUSG00000038085   Transcript: ENSMUST00000073942
Sequence length 425
Comment pep:putative chromosome:GRCm38:2:156312592:156357102:1 gene:ENSMUSG00000038085 transcript:ENSMUST00000073942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNRVCKMFRQGLRGFREYQIIEPVHKKHPDFSFWDKKKQGRISFVTEDFAAQEGHFPPR
AISITQKKPSWRTHQEIQDLCNILQALDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKG
QMGNSFYFIYLGTVAITEDEDGSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEE
TEFLVVDREDFVANKLGDEVQKETQYRYNFFRNLDIFQSWSEEKLWKLVALGRIERFSYG
QMVSKDFMNSAFITFICQGNCEILRLVALGDCSAYYKWVWQQLELLDHKPLRIHDNGFLC
VALAVLVKDPRGGWSINLRRPSQGSARPRFGCNQQEALLGTRVPGRLSLSEDWRAECGVL
TLFIGLGLGSKKRGYRSEKRAEWLVQIKAWGISWSFGEPETEVGLFQKLLLVPLYLGTIG
SWPLS
Download sequence
Identical sequences A2AV95
ENSMUSP00000073598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]