SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000073866 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000073866
Domain Number 1 Region: 201-318
Classification Level Classification E-value
Superfamily SH2 domain 5.79e-24
Family SH2 domain 0.00071
Further Details:      
 
Domain Number 2 Region: 562-721
Classification Level Classification E-value
Superfamily Ras GEF 8.89e-22
Family Ras GEF 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000073866   Gene: ENSMUSG00000059013   Transcript: ENSMUST00000074248
Sequence length 854
Comment pep:known chromosome:GRCm38:2:32721055:32754994:1 gene:ENSMUSG00000059013 transcript:ENSMUST00000074248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEMPKKTGRKFKFFKFKGLGSLSNLPRSFSLRRSSASASIRSCPEPDTFEATQDDMVTL
PKSPPAYARSSDMYSHMGTMPRPNIKKAQKQQAVQKAQEVSRESHLVSRRLPEPPDLEAA
KEAGEGTEALLEDTAPSAVEVDPMRELEDLTVDTEKEQVPGDVSPERTAAELEAAGDYVK
FSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDS
LTSLGDYVLTCRWHNQALHFKINKVVVKAGESYTHIRYLFEQESFDHVPALVRYHVGSRK
AVSEQSGAIIYCPVNRTFPLRYLEASYGLSQGSSKTASPASPSGSKGSHMKRRSITMTDG
LTTDKVTRSDGCPNSTSLPHPRDSIRNCALSMDQIPDLHSPLSPISESPSSPAYSTVTRV
HAPSATPSTSAQPASPVARRSSEPQLCPGNTPKPPGESDRAPHASPSHTLCKASPSPSLS
SYSDPDSGHYCQLQPPVRGSREQAAGETPRKARGSGERQKELLENGVSDGEWGKTFTVPV
VEATSSFNLATFQSQLIPKENRPLEVALLRKVKELLSEVDARTLARHVTKVDCLVARILG
VTKEMQTLMGVRWGMELLTLPHGRQLRLDLLERFHTMSIMLAVDILGCTGSAEERAALLH
KTIQLAAELRGTMGNMFSFAAVMGALEMAQISRLEQTWMTLRQRHTEGAILYEKKLKPFL
KSLNEGKEGPPLSNTTFPHVLPFITLLECDSAPAEGPEPWGSTEHGVEVVLAHLEAARTV
AHHGGLYHTNAEVKLQGFQARPELLEVFSTEFQMRLLWGSQGANSSQAWRYEKFDKVLTA
LSHKLEPAIRSSEL
Download sequence
Identical sequences Q9QZS8
ENSMUSP00000073866 NP_038809.1.92730 10090.ENSMUSP00000073866 ENSMUSP00000073866 ENSMUSP00000073866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]