SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000076115 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000076115
Domain Number 1 Region: 29-163
Classification Level Classification E-value
Superfamily Cupredoxins 2.43e-52
Family Ephrin ectodomain 0.0000000899
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000076115   Gene: ENSMUSG00000048915   Transcript: ENSMUST00000076840
Sequence length 228
Comment pep:known chromosome:GRCm38:17:62604184:62881317:-1 gene:ENSMUSG00000048915 transcript:ENSMUST00000076840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHVEMLTLLFLVLWMCVFSQDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDK
VENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
Download sequence
Identical sequences A0A1U7QYA5 O08543
ENSMUSP00000076115 NP_997537.1.92730 XP_004652540.1.11716 XP_005077232.1.91757 XP_021073490.1.100879 ENSMUSP00000076115 10090.ENSMUSP00000076115 10116.ENSRNOP00000039406 ENSRNOP00000039406 ENSRNOP00000039406 ENSMUSP00000076115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]