SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000076564 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000076564
Domain Number 1 Region: 244-491
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.62e-67
Family Leukotriene A4 hydrolase catalytic domain 0.000000589
Further Details:      
 
Domain Number 2 Region: 501-645
Classification Level Classification E-value
Superfamily ARM repeat 8.06e-38
Family Leukotriene A4 hydrolase C-terminal domain 0.001
Further Details:      
 
Domain Number 3 Region: 24-237
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 8.37e-35
Family Leukotriene A4 hydrolase N-terminal domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000076564   Gene: ENSMUSG00000041926   Transcript: ENSMUST00000077340
Sequence length 650
Comment pep:known chromosome:GRCm38:1:135262712:135284084:-1 gene:ENSMUSG00000041926 transcript:ENSMUST00000077340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGGPGNYSAAARRPLHSAQAVDVASASSFRAFEILHLHLDLRAEFGPPGPGPGSRGLS
GTATLELRCLLPEGASELRLDSHSCLEVTAATLRRGQPGDQQAPAEPVPFHTQPFSHYGQ
ALCVAFRQPCGAADRFELELTYRVGEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFP
CFDTPAVKCTYSALIEVPDGFTAVMSADTWEKRGPNKFFFQMSHPIPSYLIALAIGDLAS
AEVGPRSRVWAEPCLIEAAKEEYSGVIEEFLATGEKLFGPYVWGRYDLLFMPPSFPFGGM
ENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRIST
ILFGAAYTCLEAATGRALLRQHMNVSGEENPLNKLRVKIEPGVDPDDTYNETPYEKGYCF
VSYLAHLVGDQDQFDKFLKAYVDEFKFQSILAEDFLEFYLEYFPELKKKGVDSIPGFEFD
RWLNTPGWPPYLPDLSPGDSLMKPAEELAELWVTSEPDMQAIEAVAISTWKTYQLVYFLD
KILQKSPLPPGNVKKLGETYPKISNAQNAELRLRWGQIILKNDYQEEFQKVKDFLQSQGK
QKYTLPLYHAMMGGSEMARTLAKDTFAATASQLHSNVVNYVQQILAPKDS
Download sequence
Identical sequences Q8VCT3
NP_663392.2.92730 ENSMUSP00000073962 10090.ENSMUSP00000076564 ENSMUSP00000076564 ENSMUSP00000076564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]