SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000076850 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000076850
Domain Number 1 Region: 433-577
Classification Level Classification E-value
Superfamily CBS-domain pair 4.53e-16
Family CBS-domain pair 0.01
Further Details:      
 
Domain Number 2 Region: 614-722,769-796
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000529
Family cAMP-binding domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000076850   Gene: ENSMUSG00000064105   Transcript: ENSMUST00000077666
Sequence length 853
Comment pep:known chromosome:GRCm38:19:46761596:46878795:1 gene:ENSMUSG00000064105 transcript:ENSMUST00000077666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIGCGACEPEVKMAGGQAAAALPTWKMAARRSLSARGRGVLQAAAGRLLPLLLLSCCWGA
GGCTAAGENEETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVYGQNINNETWSRIAF
TEHERRRHTPSERGLGGPAPPEPDSGPQRCGIRTSDIIILPHIILNRRTSGIIEIEIKPL
RKMEKSKSYYLCTSLSTPALGAGGSGSASGTVGGKGGAGVAGLPPPPWAETTWIYHDGED
TKMIVGEEKKFLLPFWLQVIFISLLLCLSGMFSGLNLGLMALDPMELRIVQNCGTEKEKN
YAKRIEPVRRQGNYLLCSLLLGNVLVNTTLTILLDDIAGSGLVAVVVSTIGIVIFGEIVP
QAICSRHGLAVGANTIFLTKFFMMMTFPASYPVSKLLDCVLGQEIGTVYNREKLLEMLRV
TDPYNDLVKEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTR
IPVFEGERSNIVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKK
GKSHLAIVQRVNNEGEGDPFYEVLGIVTLEDVIEEIIKSEILDETDLYTDNRTKKKVAHR
ERKQDFSAFKQTDSEMKVKISPQLLLAMHRFLATEVEAFSPSQMSEKILLRLLKHPNVIQ
ELKYDEKNKKAPECYLYQRNKPVDYFVLILQGKVEVEAGKEGMKFEASAFSYYGVMALTA
SPGENKSPPRPCGLNHSDSLSRSDRIDAMTPTLGSSNNQLSSSFLQVYIPDYSVRALSDL
QFVKISRQQYQNALMASRMDKTPQSSDSENTKIELTLTELHDGLPDETANLLNEQNCVSH
NKANHSLHSEGAI
Download sequence
Identical sequences ENSMUSP00000076850 NP_001095941.1.92730 10090.ENSMUSP00000076850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]