SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000076887 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000076887
Domain Number 1 Region: 21-144
Classification Level Classification E-value
Superfamily Lysozyme-like 1.18e-38
Family C-type lysozyme 0.0000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000076887   Gene: ENSMUSG00000032530   Transcript: ENSMUST00000077706
Sequence length 145
Comment pep:known chromosome:GRCm38:9:121577843:121641566:-1 gene:ENSMUSG00000032530 transcript:ENSMUST00000077706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLYLVLLLISYLLTPIGASILGRCTVAKMLYDGGLNYFEGYSLENWVCLAYFESKFNPS
AVYEDPQDGSTGFGLFQIRDNEWCGHGKNLCSVSCTALLNPNLKDTIQCAKKIVKGKHGM
GAWPIWSKNCQLSDVLDRWLDGCDL
Download sequence
Identical sequences Q78ID0 Q9D925
NP_081191.1.92730 XP_006512311.1.92730 10090.ENSMUSP00000076887 ENSMUSP00000076887 ENSMUSP00000076887 ENSMUSP00000113034 ENSMUSP00000076887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]