SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000077074 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000077074
Domain Number 1 Region: 344-594
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.18e-68
Family Eukaryotic proteases 0.00053
Further Details:      
 
Domain Number 2 Region: 113-223
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-18
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0085
Further Details:      
 
Domain Number 3 Region: 49-109
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000115
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 4 Region: 264-299
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 5 Region: 230-261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000077074   Gene: ENSMUSG00000058952   Transcript: ENSMUST00000077918
Sequence length 603
Comment pep:known chromosome:GRCm38:3:129836739:129875328:1 gene:ENSMUSG00000058952 transcript:ENSMUST00000077918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLAHLSLFLLALHLSSSRSPSASDLPQEELVDQKCLLQKYTHRSCNKVFCQPWQRCIEG
TCICKLPYQCPRAGTPVCAMNGRSYPTYCHQKSFECLHPEIKFSHNGTCAAEGKFNVSLI
YGRTKTEGLVQVKLVDQDERMFICKNSWSMAEANVACVDLGFPLGVRDIQGSFNISGNLH
INDTECLHVHCRGVETSLAECAFTKRRTELSNGLAGVVCYKQDADFPTSLSFQCVNGKHI
PQEKACNGVNDCGDQSDELCCKGCRGNASLCKSGVCIPDQYKCNGEVDCITGEDESRCEE
DRQQNIPKGLARSAQGEAEIETEETEMLTPGMDNERKRIKSLLPKLSCGVKRNTHTRRKR
VIGGKPANVGDYPWQVAIKDGQRITCGGIYIGGCWILTAAHCVRPSRAHSYQVWTALLDW
LKPNSQLGIQTVKRVIVHEKYNGATFQNDIALIEMKMHTGKKECELPNSVPACVPWSPYL
FQPNDRCIISGWGRGKDNQKVYSLRWGEVDLIGNCSQFYPDRYYEKEMQCAGTRDGSIDA
CKGDSGGPLVCEDINNVTYVWGIVSWGENCGKPEFPGVYTRVANYFDWISYHVGRSLVSQ
HNV
Download sequence
Identical sequences Q61129
ENSMUSP00000077074 NP_031712.2.92730 10090.ENSMUSP00000077074 ENSMUSP00000077074 ENSMUSP00000077074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]