SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000077200 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000077200
Domain Number 1 Region: 217-328
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 9.03e-29
Family Pentapeptide repeats 0.0013
Further Details:      
 
Domain Number 2 Region: 89-189
Classification Level Classification E-value
Superfamily POZ domain 3.14e-28
Family Tetramerization domain of potassium channels 0.0092
Further Details:      
 
Domain Number 3 Region: 2-74
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.0000085
Family Doublecortin (DC) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000077200   Gene: ENSMUSG00000034327   Transcript: ENSMUST00000078053
Sequence length 339
Comment pep:known chromosome:GRCm38:14:67716098:67742310:1 gene:ENSMUSG00000034327 transcript:ENSMUST00000078053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRVTLFLNGSPSNGKVVAVYGTLSDLLSVASSKLGIKATSVYNGKGGLIDDIALIRDDD
VLFVCEGEPFIDPQTDARPPGGLLGSHTDWLTLNVGGRYFTTTRSTLVNKEPDSMLAHMF
KDKGVWGNKQDHRGAFLIDRSPEYFEPILNYLRHGQLIVNDGINLLGVLEEARFFGIDSL
IEHLEVAIKNSQPPEDHSPISRKEFVRFLLATPTKSELRCQCANLQGVKMLCSNAEGASL
RLCNFEDPSGLKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTDL
ENCDLSGCDLQEANLRGSNVKGAIFEEMLTPLHMSQSVR
Download sequence
Identical sequences Q80UN1
NP_598834.2.92730 ENSMUSP00000077200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]