SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000077422 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000077422
Domain Number 1 Region: 38-213
Classification Level Classification E-value
Superfamily Lysozyme-like 1.49e-24
Family G-type lysozyme 0.00000787
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000077422   Gene: ENSMUSG00000061584   Transcript: ENSMUST00000078307
Sequence length 213
Comment pep:known chromosome:GRCm38:1:37905921:37916493:-1 gene:ENSMUSG00000061584 transcript:ENSMUST00000078307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPSVVFWGLIALVGTAKGSYTHSVHSMNPHVHPRLYHGCYGDIMTMETFGAPCDINNLM
NCGIHGSEMFAEMDLKAIKPYRILIKEVGQRHCIDPALIAAIISRESHGGAVLQNGWDHK
GQRFGLMQLDKNMYHPIGSWDSKEHLLQSVGILTERIKAMKRKFPTWNTAQQLKGGLTAF
KSGMETIVTPADIDGDLVDDVLARAKFYKRHGF
Download sequence
Identical sequences Q3V1I0
NP_001028599.1.92730 ENSMUSP00000077422 10090.ENSMUSP00000077422 ENSMUSP00000077422 ENSMUSP00000077422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]