SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000077883 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000077883
Domain Number 1 Region: 29-163
Classification Level Classification E-value
Superfamily Cupredoxins 8.51e-53
Family Ephrin ectodomain 0.0000000944
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000077883   Gene: ENSMUSG00000048915   Transcript: ENSMUST00000078839
Sequence length 201
Comment pep:known chromosome:GRCm38:17:62607319:62881144:-1 gene:ENSMUSG00000048915 transcript:ENSMUST00000078839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHVEMLTLLFLVLWMCVFSQDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNDTVHESAEPSRGENAAQT
PRIPSRLLAILLFLLAMLLTL
Download sequence
Identical sequences A0A1U7R0Y0
ENSMUSP00000077883 NP_034239.1.92730 XP_004652541.1.11716 XP_005077233.1.91757 XP_006245655.1.100692 XP_021073491.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]