SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000078293 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000078293
Domain Number 1 Region: 4-139
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.61e-44
Family Cofilin-like 0.000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000078293   Gene: ENSMUSG00000062014   Transcript: ENSMUST00000079314
Sequence length 142
Comment pep:known chromosome:GRCm38:14:46808149:46822242:-1 gene:ENSMUSG00000062014 transcript:ENSMUST00000079314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDE
LPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKV
FEIRNTEDLTEEWLREKLGFFH
Download sequence
Identical sequences Q9CQI3
NP_071306.2.92730 ENSMUSP00000078293 400037 ENSMUSP00000078293 ENSMUSP00000107448 ENSMUSP00000078293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]