SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000078343 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000078343
Domain Number 1 Region: 198-397
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.07e-57
Family Reprolysin-like 0.000039
Further Details:      
 
Domain Number 2 Region: 416-486
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.02e-16
Family Blood coagulation inhibitor (disintegrin) 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000078343   Gene: ENSMUSG00000062438   Transcript: ENSMUST00000079368
Sequence length 806
Comment pep:known chromosome:GRCm38:5:121500098:121503435:-1 gene:ENSMUSG00000062438 transcript:ENSMUST00000079368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERLKLGKIPEHWCIRLVAMLLLAIIFLPSTFCDIGSVYNSSYETVIPERLPGKGGKDPG
GKVSYMLLMQGQKQLLHLEVKGHYPENNFPVYSYHNGILRQEMPLLSQDCHYEGYMEGVP
GSFVSVNICSGLRGVLIKEETSYGIEPMLSSKNFEHVLYTMEHQPVVSCSVTPKDSPGDT
SHPPRSRKPDDLLVLTDWWSHTKYVEMFVVVNHQRFQMWGSNINETVQAVMDIIALANSF
TRGINTEVVLVGLEIWTEGDPIEVPVDLQTTLRNFNFWRQEKLVGRVRHDVAHLIVGHRP
GENEGQAFLRGACSGEFAAAVEAFHHEDVLLFAALMAHELGHNLGIQHDHPTCTCGPKHF
CLMGEKIGKDSGFSNCSSDHFLRFLHDHRGVCLLDEPGRQSRMRRAANCGNGVVEDLEQC
DCGSDCDKSQCCDENCKLKGNSVCSTELCCFKCNFKKEGDVCRPADGPCDLEEYCNGTSA
ACPSDRKAQDGSKCHESFLCFNGQCMDPTFQCSRIFGHGSRSASDYCYTSLNSRGDQFGN
CGSSSQFPKKYTKCSDKNVMCGKLICTEVAFLPQIQPNNLLLQVPETEDWCWSVAVFDMR
DSLHEEYVKDNTYCGKDKVCKNSICEDFTPFSFPCSPSKQCNKHGVCNDLGNCHCSFGFA
PPDCKEEGTGGSVDSGPAVNLSNDSSPGPNSTQSSTEELILNLKLIVLAVILVLMILLII
ICIISAYTKSETASEAGPSELEELPEGEKEEQEEVLPEEAKGEEEELEYGKEEAEEQGAV
EEEGAEEANEEAAAEKKDEDEEEGEE
Download sequence
Identical sequences Q8R534
10090.ENSMUSP00000078343 ENSMUSP00000078343 ENSMUSP00000078343 ENSMUSP00000078343 NP_742123.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]