SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000079295 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000079295
Domain Number 1 Region: 748-824,858-947
Classification Level Classification E-value
Superfamily RUN domain-like 7.72e-36
Family RUN domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1107-1280
Classification Level Classification E-value
Superfamily RUN domain-like 1.96e-26
Family RUN domain 0.014
Further Details:      
 
Domain Number 3 Region: 955-1052
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 3.08e-18
Family Lipoxigenase N-terminal domain 0.04
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000079295
Domain Number - Region: 634-707
Classification Level Classification E-value
Superfamily SAICAR synthase-like 0.049
Family Inositol polyphosphate kinase (IPK) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000079295   Gene: ENSMUSG00000035901   Transcript: ENSMUST00000080437
Sequence length 1287
Comment pep:known chromosome:GRCm38:7:109893780:109960470:-1 gene:ENSMUSG00000035901 transcript:ENSMUST00000080437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGGGGGGSAPSRFADYFVICGLDTETGLEPDELSALCQYIQASKARDGASPFISSTTE
GENFEQTPLRRTFKSKVLARYPENVDWNPFDQDAVGMLCMPKGLAFKTQADPREPQFHAF
IITREDGSRTFGFALTFYEEVTSKQICSAMQTLYHMHNAEYDVLHAPLADGGDQSGMEDG
EGIPGTKLQRFNSYDISRDTLYVSKCICLITPMSFMKACRSVLQQLHQAVTSPQPPPLPL
ESYIYNVLYEVPLPPPGRSLKFSGVYGPIICQRPSTNELPLFDFPVKEVFELLGVENVFQ
LFTCALLEFQILLYSQHYQRLMTVAETITALMFPFQWQHVYVPILPASLLHFLDAPVPYL
MGLHSNGLDDRSKLELPQEANLCFVDVDNHFIELPEDLPQFPNKLEFVQEVSEILMAFGV
PPEGNLHCSESASKLKRIRASELVSDKRNGNIAGSPLHSYELLKENETIARLQALVKRTG
VSLEKLEVREDPSSNKDFKVQCDEEELRIYQLNIQIREVFANRFTQMFADYEVFVIQPSQ
DKESWFTNREQMQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPV
LRVFDSRVDKIRLLNVRTPTLRTSMYQKCTTVDEAEKAIELRLAKIDHTAVHPHLLDMKI
GQGKYEPGFFPKLQSDVLCTGPASNKWTKRNAPAQWRRKDRQKQHTEHLRLDNDQREKYI
QEARNMGSTIRQPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKMGREAVELGHG
EVNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQENRQRKLTSGSLSTS
GILLDSERRKSDASAVMSPLRISLIQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRH
LKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTILIPYHILI
VPSKKLGGSMFTANPWICISGELGETQILQIPRNVLEMTFECQNLGKLTTVQIGHDNSGL
YAKWLVECVMVRNEVTGHTYKFPCGRWLGKGMDDGSLERVLVGELLTSLPEVDERPCRTP
PLQQSPSVIRRLVTISPNNKPKLNTGQIQESIGEAVNGIVKHFHKPEKERGSLTLLLCGE
CGLVSALEQAFQHGFKSPRLFKNVFIWDFLEKAQTYYETLEQNDVVPEENWHTRARNFCR
FVTAVNNTPRNIGKDGKFQMLVCLGARDHLLHHWIALLADCPITAHMYEDVALIKDHTLV
NSLIRVLQTLQEFNITLDTSLVKGIDI
Download sequence
Identical sequences Q6PAL8
ENSMUSP00000079295 ENSMUSP00000079295 NP_067469.1.92730 ENSMUSP00000079295 10090.ENSMUSP00000079295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]