SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000080469 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000080469
Domain Number 1 Region: 960-1244
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.14e-78
Family Complement components 0.0000402
Further Details:      
 
Domain Number 2 Region: 1317-1448
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 3.01e-41
Family Alpha-macroglobulin receptor domain 0.00000177
Further Details:      
 
Domain Number 3 Region: 788-908
Classification Level Classification E-value
Superfamily E set domains 1.68e-25
Family SVA-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000080469   Gene: ENSMUSG00000030131   Transcript: ENSMUST00000081777
Sequence length 1451
Comment pep:known chromosome:GRCm38:6:122006798:122085967:1 gene:ENSMUSG00000030131 transcript:ENSMUST00000081777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKSRRAQLCLFSVLLAFLPSASSLNGDSKYMVLVPSQLYTETPEKICLHLYHLNETVTV
TASLVSQTGRRNLFDELVVDKDLFQCVSFIIPTLNSPDEEEFLYVDIKGPTHEFSKRNAV
LVKNKESVVFVQTDKPVYKPGQSVKFRVVSMDKTLRPLNELLPLAYIEDPKKNRIMQWRD
IKTENGLKQMSFSLAAEPIQGPYKIVVHKQSGVKEEHSFTVMEFVLPRFNVDLKVPNAIS
VNDEVLQVTVCGKYTYGKPVPGQVKISICHETEAGCKEVNSKLDNNGCSTQEVNITELQS
KKRNYEVQLFHVNATVTEEGTGLEFNGYGTTKIERITNKLIFLKADSHFRHGIPFFVKVR
LVDIKGDPIPNERVFIKAQVLGYTSATTTDQHGLAKFSIDTAGFSGSSLHIKVNHKGKDS
CYFFYCMEERYASAEHVAYAVYSLSKSYIYLVKETSSILPCNQIHTVQAHFILKGDLGVL
KELVFYYLVMAQGSIIQTGNHTHQVEPGEAPVKGNFDLEIPVEFSMAPMAKMLIYTILPD
GEVIADSVNFEIEKCLRNKVDLSFSSSQSLPASQTRLQVTASPQSLCGLRAVDQSVLLLK
PEDELSPSWIYNLPGMQHNKFIPSSSLSEDREDCILYSSWVAEKHTDWVPHGREKDVYRY
VEDMDLKAFTNLKIKLPKICFDSAPMSGPRGKFDLAFSSEVSGTLQKGSSKRPQPEEPPR
EDPPPKDPLAETIRKYFPETWVWDIVTVNSTGVAEVEMTVPDTITEWKAGALCLSNDTGL
GLSSVVPLQAFQPFFVEVSLPYSVVRGEAFMLKATVMNYLPTSMRMSVQLEASPDFTAVP
VGDDHDSYCLSANGRHTSSWLVTPKSLGNVNFSVSVEAQQSSEPCGSEVATVPETGRKDT
VVKVLIVEPEGIKQEHTFNSLFCASDAEISEKMSLVLPPTVVKDSARAHFSVMGDILSSA
IKNTQNLLHMPYGCGEQNMVLFAPNIYVLKYLDKTQQLTQKIKTKALGFLRAGYQRELNY
KHKDGSYSAFGDQNGEREGNTWLTAFVLKSFAQARAFIFIDESHITHAFTWLSQQQKDNG
CFRSSGSLFHNDIKHPVVSKALSCLESSWKTIEQGRNANFVYTKALMAYAFALAGNQDKR
NEILKSLDEEAIKEDNSIHWERPQKPRKSEHNLYKPQASSVEVEMNAYVVLARLTAQPAP
SPEDLTLSRSTIMWLTKQQNSNGGFSSTQDTVVALDALSKYGAVTFSRRQKTSLVTIQST
GSFSQKFQVENSNCLLLQQVPLPDIPGDYTISVSGEGCVYAQTTLRYNMHLEKQQSAFAL
RVQTVPLTCNNPKGHNSFQISLEISYTGSRPASNMVIADVKMLSGFIPLKPTVKKLERLE
HISRTEVSNNNVLLYLDQVTNQTLAFSFIIQQDISVRNLQPAIVKVYDYYETDEVAYAEY
SSPCSSDKQNV
Download sequence
Identical sequences P28666
ENSMUSP00000080469 ENSMUSP00000080469 ENSMUSP00000080469 10090.ENSMUSP00000080469 NP_032672.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]