SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000080489 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000080489
Domain Number 1 Region: 587-650,824-943
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.41e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0068
Further Details:      
 
Domain Number 2 Region: 8-96,123-200
Classification Level Classification E-value
Superfamily RUN domain-like 6.93e-34
Family RUN domain 0.0017
Further Details:      
 
Domain Number 3 Region: 921-1042
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.23e-25
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000080489   Gene: ENSMUSG00000038351   Transcript: ENSMUST00000081799
Sequence length 1050
Comment pep:known chromosome:GRCm38:11:74849266:74897060:-1 gene:ENSMUSG00000038351 transcript:ENSMUST00000081799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSAEDAVKEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAA
GFLRSDKMAALFTKVGKTCPVAEDICHKVQELQQQAEGRKPSGGSQEALRKQGSTGGKAP
ALSPQALKHIWVRTALMEKVLDRVVQYLAENCSKYYEKEALLADPVFGPILACLLVGPCA
LEYTKLKTADHYWTDPSADELVQRHRIRGPPNRQDSPAKRPALGIRKRHSSGSASEDRLA
ACAREYVESLHQNSRTRLLYGKNNVLVQPKEDMEAVPGYLSLHQSAENLTLKWTPNQLMN
GTLGDSELEKSVYWDYALVVPFSQIVCIHCHQQKSGGTLVLVSQDGIQRPPLHFPQGGHL
LSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPKLRKRSSIRSIDVEELGVGRATDYVFRI
IYPGHRHEHITINYHHLAASRAASVDDDEEEEDKLHAMLSMICSRNLTAPNPMKDAGDMI
EMQGFGPSLTAWHLEPLCSQGSSCLSCSSSSSPYATPSHCSCIPDRLPLRLLCESMKRQI
VSRAFYGWLAYCRHLSTVRTHLSALVHHNIIPPDRPPGASGGLTKDVWSKYQKDEKNYKE
LELLRQVYYGGVEHEIRKDVWPFLLGHYKFGMSKKEMEQVDTAVAARYQQVLAEWKACEV
VVRQREREAHPATLTKFSSGSSIDSHVQRLVHRDSTISNDVFISVDDLEPSGPQDLEDSK
PKREQEPGAGTPGIAAAEQQSVEFDSPDSGLPSSRNYSVASGIQSSLDEAQSVGFEDDGA
GEDGSEGPATAAHTFPGPHDPGQETLAPASELEAGQELAAVCAAAYTIELLDTVALNLHR
IDKDVQRCDRNYWYFTTSNLERLRDIMCSYVWEHLDMGYVQGMCDLLAPLLVILDNDQLA
YSCFSHLMKRMGQNFPSGGAMDSHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFL
LDFKRELLYEDVFAVWEVIWAARRISSEHFVLFIALALVEAYREIIRDNNMDFTDIIKFF
NERAERHDAQEILRIARDLVHKVQMLIDNK
Download sequence
Identical sequences 10090.ENSMUSP00000080489 ENSMUSP00000080489 ENSMUSP00000080489 XP_006534644.1.92730 ENSMUSP00000080489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]