SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000080994 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000080994
Domain Number 1 Region: 91-224
Classification Level Classification E-value
Superfamily Cupredoxins 1.13e-59
Family Periplasmic domain of cytochrome c oxidase subunit II 0.000000556
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit II-like, transmembrane region 2.94e-29
Family Cytochrome c oxidase subunit II-like, transmembrane region 0.00000472
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000080994   Gene: ENSMUSG00000064354   Transcript: ENSMUST00000082405
Sequence length 227
Comment pep:known chromosome:GRCm38:MT:7013:7696:1 gene:ENSMUSG00000064354 transcript:ENSMUST00000082405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE
VETIWTILPAVILIMIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS
YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN
QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI
Download sequence
Identical sequences A0A023J6F3 A0A096XKL3 A0A096XKQ3 A0A0F6PXF3 A3R455 B2L0P0 B7SE77 E7C9L4 P00405 Q5GA81 Q7JCZ1 Q7JD03
ENSMUSP00000080994 NP_904331.1.92730 10090.ENSMUSP00000080994 ENSMUSP00000080994 ENSMUSP00000080994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]